SKU: 68792454489

Biotinylated VSIG3/IGSF11 Fc&Avi Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated VSIG3/IGSF11 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CXADRL1, Bt IgSF, CT119 Accession Q5DX21 1 Amino Acid Sequence Leu23 Gly245, with C terminal Human IgG1 Fc &Avi Tag

Product Specification


Species Human
Synonyms CXADRL1, Bt-IgSF, CT119
Accession Q5DX21-1
Amino Acid Sequence

Leu23-Gly245, with C-terminal Human IgG1 Fc &Avi Tag LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight 60-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Suzu S, Hayashi Y, Harumi T, Nomaguchi K, Yamada M, Hayasawa H, et al. Molecular cloning of a novel immunoglobulin superfamily gene preferentially expressed by brain and testis. Biochem Biophys Res Commun (2002) 296(5):1215-21.

Background

VSIG3 (V-set and immunoglobulin domain containing 3) is a member of the immunoglobulin superfamily (IgSF), which is also called the immunoglobulin superfamily 11 gene (IgSF11), and it is highly expressed in the brain and testis. Mature human VSIG3 consists of a 219 amino acid (aa) extracellular domain (ECD) that contains two tandem Ig-like domains, a 21 aa transmembrane segment, and a 169 aa cytoplasmic domain. The function of VSIG3 is to stimulate cell growth through homophilic interactions. In clinical, the VSIG3 has been reported to as a novel target for cancer immunotherapy of gastrointestinal and hepatocellular carcinomas. In addition, VSIG-3 is also a ligand of B7 family member VISTA/PD-1H and inhibits human T-cell functions through a novel VSIG-3/VISTA pathway.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68792454489

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Naturelover
Massapequa, US
★★★★★ 5
A must have for wildlife lovers
Format: Paperback
Wow! What an excellent and thorough compilation of scat and tracks. Nice reference for when you take pics and bring the image back to the book for comparison. Also, great information about tracking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2025
A
Verified Purchase
Allison
Dallas, US
★★★★★ 4
Good but index needs improvement
Format: Paperback
This is a good, comprehensive guide to tracks and sign. However, there is no index of where to find each family, so in order to find a species you have to flip through the entire book looking for the right page. This makes it annoying to use if you are trying to look up information on a particular species or family.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
E
Verified Purchase
ed calvin
Bozeman, US
★★★★★ 5
This is a very useful field manual for those interested in detailed traking methodology.
Format: Paperback
I spent many years as interpreter and ranger for the Colorado State Park System, now called CPW—Colorado Parks and Wildlife. We were annually tasked with surveying a given species' presence, density, and range in the park system and surrounding areas. Detailed field manuals were critical to the accuracy of our work, and HOW I WISH I HAD THIS BOOK DURING THAT PART OF MY CAREER. There are few other books I've come across providing detailed, yet very accessible information on how trail sign reflects animal behavior across different conditions, landscapes, and seasons (both weather seasons and mating seasons). One particular aspect of this book I found significantly intriguing was the section on predation—how does a mountain lion take down a mule deer vs. how wolves bring one down. The locations on a prey animal where a certain predator is most likely to attack, showing illustrations, is a remarkable piece of work, and there authors are clearly masters of interpreting tracks and sign! If you want learn about how mammals behave in their native environment, adding this book to your field manual packet will greatly expand your horizons! Busy it, read it, and get outside! Thank you Mr. Elbroch and Mr. McFarland for adding to the wildlife canon!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2023
N
Verified Purchase
naughtyzut
Lake Worth, US
★★★★★ 5
Great book and very useful tool to have
Format: Paperback
I had the older edition and lived it, but someone at my last job *borrowed* it and I never saw it again. This edition sends even better than the last, and I have that one five stars. Great pictures and the number of species covered means it's good in at least all states I've worked in.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 16, 2025
N
Verified Purchase
Nandita Banerjee
Fort Morgan, US
★★★★★ 5
Simply unputdownable
Format: Kindle
B N William’s field guide is fascinating. The book uncovers the bizarre reality beneath the polished propaganda of the Second World War, exploring the wonderfully weird truths where the line between brilliant innovation and sheer insanity vanishes completely. Every unusual piece of information has been verified using official declassified archives. I loved the story of Wojtek, a Syrian brown bear, who became a beloved and legendary figure, known for his unique story as an enlisted soldier. Read many more such stories and episodes in this book. You will enjoy them thoroughly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 25, 2025

recommand products