SKU: 68803853175

Human CD326/EPCAM, His tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD326/EPCAM, His tagProduct Specification Species Human Synonyms Adenocarcinoma associated antigen, Cell surface glycoprotein Trop 1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1 4 antigen, KSA, Major gastrointestinal tumor associated protein GA733 2, Tumor associated calcium signal transducer 1, GA733 2, M1S2, M4S1, MIC18, TACSTD1, TROP1 Accession P16422 Amino Acid Sequence Protein sequence (P16422,

Product Specification


Species Human
Synonyms Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1/4 antigen, KSA, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1
Accession P16422
Amino Acid Sequence

Protein sequence (P16422, Gln24-Lys265, with C-10*His) QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 29.1 kDa Observed MW: 32,33 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Epithelial cell adhesion molecule (EpCAM), also known as CD326 among other names, is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell–cell adhesion in epithelia. EpCAM is also involved in cell signaling, migration, proliferation, and differentiation. Additionally, EpCAM has oncogenic potential via its capacity to upregulate c-myc, e-fabp, and cyclins A & E. Since EpCAM is expressed exclusively in epithelia and epithelial-derived neoplasms, EpCAM can be used as diagnostic marker for various cancers. It appears to play a role in tumorigenesis and metastasis of carcinomas, so it can also act as a potential prognostic marker and as a potential target for immunotherapeutic strategies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68803853175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LanaB
Whiting, US
★★★★★ 5
Ends in a cliffhanger
Format: Kindle
Thankfully, the next book is already available. Roxy Collins is the queen of omegaverse slow burn. This particular series is omegaverse with wolf shifters. Thoroughly enjoyed this book! Lots of suspense and trying to figure out what is true and what's really going on. I loved it! Pretty spicy once the action starts. Heats are pretty much always spicy. There is a little bit of male interaction, but not full-on shmex. Definitely recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2025
D
Verified Purchase
Dolores Evans
Dallas, US
★★★★★ 5
Epic!!!!
Format: Kindle
Absolutely addicted from the first page. The twists and turns, world building and character development all come together for the perfect Omegaverse. And let's not forget that spice because knots are life and these are spectacular. Running for book #2 because that cliffhanger was torturous.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 17, 2024
A
Verified Purchase
Amanda
Chelsea, US
★★★★★ 5
A good read
Format: Kindle
A good read, just fluffy cuteness, no antagonism. I like all the characters. It could have used another round of editing however, glanfds being one error that cracked me up, and my personal pet peeve was that the author kept using the word fill instead of feel, which I promise you are not interchangeable haha, but it's definitely better than the majority of books I read on here mistake-wise.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 28, 2024
C
Verified Purchase
Cecy Melero
New York, US
★★★★★ 4
amazing
Format: Kindle
Knot the Bride was a fantastic read! The characters were all amazing and well-developed. It was easy to like them all. Sophia, Luca, Nick, and Gavin were all perfect for each other. It was such a charming story that had me hooked the entire time. I did wish there were POVs from Luca, Nick, and Gavin but it was still an amazing book without it. I am excited to read the next book in the Willowside Omegaverse series! This is definitely a must-read for fans of omegaverse romance!. I received a free copy of this book and am voluntarily leaving a review.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2025
T
Verified Purchase
Tara
Lake Worth, US
★★★★★ 3
3 Star Read,
Format: Kindle
This book wasn't bad, but wasn't my cup of tea. It's highly disappointing because the storyline is so original. There is no real conflict or resolution, so the entire thing feels flat. As a lover of omegaverse books, I know there is a ton of variety out there, and ov is really up to the author. But this one is weird. Omegas have multiple scent glands all over their bodies and go into week long heats every month. Alphas have knots in the middle of their shaft instead of the base, and the knot doesn't always swell, no explanation of when or why. It doesn't engage at all when the mouth is in play. I also didn't enjoy the author's writing style. Each paragraph is only 1 or 2 sentences long, and the entire book reads very stacato. The conversations are stiff and unnatural feeling. Everything is very repetitive, both in word choice and in thought. The same thing is repeated 3 or 4 times over a single page, multiple times over. I ended up doing so much skimming. The first 50% of the book is all slow burn, and the last 50% is almost straight mediocre spice. This wouldn't have been all bad if the grammar and spelling errors didn't start at the exact same time. Tongue is repeatedly misspelled in the middle of the spice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 14, 2024

recommand products