SKU: 68849003700

ANGPTL3 His Tag Protein, Human

Sale price$207.00 Regular price$230.00
Save 10%

Pay in installments of $57.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 2 - Sep 7

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ANGPTL3 His Tag Protein, HumanProduct Specification Species Human Synonyms FHBL2, ANL3, ANGPT5, ANG 5 Accession Q9Y5C1 Amino Acid Sequence Ser17 Glu460, with C terminal 10*His

Product Specification


Species Human
Synonyms FHBL2, ANL3, ANGPT5, ANG-5
Accession Q9Y5C1
Amino Acid Sequence

Ser17-Glu460, with C-terminal 10*His

SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

65-78kDa and 28-33kDa(Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Angiopoietin-like protein 3 (ANGPTL3) belongs to a multifunctional secreted protein that mainly expresses in the liver, and is regulated by numerous post-translational modifications, including multiple cleavage and glycosylation. ANGPTL3 has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain and the C-terminal fibrinogen (FBN)-like domain. The N-terminal chain is important for lipid metabolism, while the C-terminal chain may be involved in angiogenesis. Accumulating evidences have revealed that ANGPTL3 plays a critical role in both biological processes, such as lipid metabolism, angiogenesis and haematopoietic function and pathological changes, including atherosclerosis, carcinogenesis, nephrotic syndrome, diabetes, liver diseases and so on. Thus, ANGPTL3 may serve as a potential biomarker in these diseases. Furthermore, ANGPTL3 signaling pathways including LXR/ANGPTL3, thyroid hormone/ANGPTL3, insulin/ANGPTL3 and leptin/ANGPTL3 are also involved in physiological and pathological processes. Some biological ANGPTL3 inhibitors, chemical drugs and traditional Chinese medicine exert beneficial effects by targeting ANGPTL3 directly or indirectly. Therefore, elucidating the effects and underlying mechanisms of ANGPTL3 is essential to develop promising strategies in the diagnosis and treatment of related diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68849003700

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kathy
Massapequa, US
★★★★★ 5
Phenomenal. A must-read!
Format: Paperback
I first learned about this book only a week ago when visiting my sister for Thanksgiving in Eugene, Oregon. We went to the Jordan Schnitzer Museum of Art where I saw some work on display by the author, and there was a copy of her book available to look at, so I perused through and decided to buy it and read it. I'm so glad that I did! This is an incredible, poetic story that spans four generations, multiple wars and conflicts, and examines the fragility of the author's relationship with her parents and with her sense of place and motherhood. This book is one of the best I've read in a long time, and the art is moving and beautiful. It gave me new insight into the struggles of refugee life, and created a truly relatable narrative. I devoured this story in one Saturday. I highly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2018
S
Verified Purchase
Sav
Lowell, US
★★★★★ 5
A well composed memoir
Format: Paperback
Full review on nguyentoread.com The Best We Could Do is Thi Bui's graphic memoir. Thi was born in Vietnam three months before the Vietnam War reached what we consider to be the end of the war. She came to America with her family in 1978. Bui's memoir spans multiple generations. In learning of her mother's and father's pasts, we learn the history of their parents. We see the struggles and pains of two people from very different walks of life trying to live during a time of war and chaos. We see glimpses of the agony everyone in the middle of the Vietnam War faced. Those who were not directly involved on either side but were caught in the middle of larger powers at war. This memoir more closely details the lives of her parents leading up to them arriving in America and making their life there. I was unsure if this memoir would focus largely on the experience of being a Vietnamese immigrant in America. There were parts that showed how it was for Bui's parents in a country where tensions were still high after the Vietnam War, where discrimination largely due to that was overt, and where degrees were not recognized and people who had spent their lives working and creating careers for themselves were not qualified for most work and had to hurdle multiple challenges to learn a language and complete education all over again if they wanted to provide a better life for their children. What Bui so beautifully captures in this memoir is the why behind how her parents were in raising her. Although Bui was born in Vietnam she was young when her family arrived in America. So I think her experience is one that many first generation Vietnamese-American people of my generation can understand and sympathize with. The wanting to know why their parents are the way they are but unable to ask because many have parents, like Bui's mother, who reluctantly share their stories and don't allow their children that glimpse that could help them better understand. In the panel which was most poignant to me, Bui draws her father as he looks over her work that would become The Best We Could Do. He says "You know how it was for me. And why later I wouldn't be... normal."
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2019
N
Verified Purchase
Noah Beitzel
Draper, US
★★★★★ 5
This book made me love my parents more
Format: Kindle
I loved the raw depictions of vietnamese history and human emotions. I recommend this book to anyone experiencing intergenerational trauma. 5 stars, this book helped me understand my father and mother just a little more, and that is priceless
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 25, 2025
A
Verified Purchase
Andres Hoyos
Lowell, US
★★★★★ 5
Excellent customer service
Format: Paperback
Totally recommendable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2019
A
Verified Purchase
Amazon Customer
Charlottesville, US
★★★★★ 5
Five Stars
Format: Paperback
This helped a lot for us to prepare for the SLATE exam.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 23, 2016

recommand products