SKU: 69269084483

Human ANGPT2 Protein, His tag

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ANGPT2 Protein, His tagProduct Specification Species Human Synonyms Angiopoietin 2, ANG 2 Accession O15123 Amino Acid Sequence Protein sequence (O15123, Asp68 Phe496, with C His tag)

Product Specification


Species Human
Synonyms Angiopoietin-2, ANG-2
Accession O15123
Amino Acid Sequence

Protein sequence (O15123, Asp68-Phe496, with C-His tag) DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Expression System HEK293
Molecular Weight

Predicted MW: 51 kDa Observed MW: 72 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Angiopoietin - 2 (ANGPT2) is a significant protein in the angiopoietin family. It plays a crucial role in angiogenesis, the process of new blood vessel formation. ANGPT2 is produced by endothelial cells and acts as a key regulator in vascular remodeling. Functionally, ANGPT2 binds to the Tie2 receptor on endothelial cells. In the presence of vascular endothelial growth factor (VEGF), ANGPT2 promotes endothelial cell destabilization, leading to increased vascular permeability and facilitating angiogenesis. However, in the absence of VEGF, it can cause vessel regression. Abnormal levels of ANGPT2 have been linked to various pathological conditions. In cancer, elevated ANGPT2 often correlates with tumor angiogenesis and metastasis, as tumors rely on new blood vessels for growth and spread. Additionally, it is involved in inflammatory diseases and eye disorders related to abnormal blood vessel growth, making it an important target for research into novel therapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69269084483

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
Chelsea, US
★★★★★ 5
Works & smells great!
Size: 6 Fl Oz (Pack of 1)
Works & smells great!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
L
Verified Purchase
lauren bensley
Fort Morgan, US
★★★★★ 5
Great smell
Size: 2 Fl Oz (Pack of 1)
Smells amazing, and goes on clear
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
M
Verified Purchase
Matthew Shesko
Cuba, US
★★★★★ 5
“Holy Sun Protection, Batman! This Stuff Works!” 🦇🦸‍♂️
Size: 6 Fl Oz (Pack of 1)
The COOLA Organic Sunscreen SPF 50 Sunblock is the real deal. It goes on smooth, absorbs quickly, and doesn’t leave behind that greasy, chalky layer most sunscreens do. I put it to the test during a full day outdoors, and it held strong—no burns, no irritation, just solid protection. What makes it even better is the formula: not overloaded with harsh chemicals, but still highly effective. It feels more like skincare than sunscreen, which makes reapplying far less of a chore. If Batman and Robin swapped their capes for beach towels, this would be the sunblock in their utility belts—powerful protection, clean ingredients, and a formula that actually works when the heat is on. 🦇☀️ Would you like me to also create short funny one-liner summaries for each review (like quick taglines), so you have both the full review and a quick punchy line to use?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 19, 2025
S
Verified Purchase
Sarah
Charlottesville, US
★★★★★ 4
will most likely buy again
Size: 6 Fl Oz (Pack of 1)
pros: clear, smells amazing, multiple spf choices cons: leaves a coat of grease on the skin (but not as bad as other brands), expensive
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 4, 2025
C
Verified Purchase
Careful Shopper
Chelsea, US
★★★★★ 5
Great scent and no sunburns
Size: 6 Fl Oz (Pack of 1)
This is easy to spray on, not sticky and smells delicious! Most important, no sunburn!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 25, 2025

recommand products