SKU: 70108479991

IL-18BP His Tag Protein, Human

$142.83 $158.70
Save 10%
No.2 Bestseller on lamcf.fr >

Pay in installments of $39.67 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-18BP His Tag Protein, HumanProduct Specification Species Human Antigen IL 18BP Synonyms IL18BP, IL18BPa, Tadekinig alfa Accession O95998 2 Amino Acid Sequence Thr31 Gly194, with C terminal 8*His TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 40 50kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Human
Antigen IL-18BP
Synonyms IL18BP, IL18BPa, Tadekinig-alfa
Accession O95998-2
Amino Acid Sequence

Thr31-Gly194, with C-terminal 8*His TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight

40-50kDa
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.
Reference

1. Review Front ImmunoQl . 2013 Oct 8;4:289.

Background

Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. IL-18BP is a cytokine receptor that belongs to the interleukin 1 receptor family. IL18BP shares many characteristics with soluble cytokine receptors of the IL1 family in that the protein exhibits specificity for IL18, belongs to the immunoglobulin-like class of receptors and has limited amino acid sequences with those of the IL1 receptor type II. According to the other study, IL1R9 is evolutionarily related to IL18BP and may function as an IL-18 receptor. Plasma il-18 /IL18BP levels increase during disease activity, suggesting that it may play a role in the pathogenesis of ITP.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 70108479991

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
L K
Carnegie, US
★★★★★ 5
Versatile and decent size
Color: Black, Color: Black
I love little trays for random things. I saw this and had to get it. I ordered the black one. It came nicely packaged in a box that protected it from any damage during transport. It is approximately 8” x 8” x 1.6.” It is made of faux leather and MDF. It is supposedly water-resistant, but I have tested that. The interest in smooth, while the exterior walls have vertical ridges. The bottom is smooth. It’s heavy enough so it doesn’t side around. I have used it for numerous things: jewelry, pens and notepads, keys and sunglasses, perfume, medications, change, remotes, and change. It’s a handy and modern piece that could suit most people.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 11, 2025
L
loumarjr
Fort Morgan, US
★★★★★ 5
Small Valet Tray Nightstand Organizer (Black)
Color: Black, Color: Black
I really love the leather look of this valet tray. It’s both stylish and functional, giving a classy touch to my nightstand while keeping small items neatly organized. The PU leather finish feels smooth, looks high-end, and the construction feels sturdy. Pros: Elegant PU leather design with a textured finish Compact 8x8 inch size fits perfectly on nightstands, dressers, or desks Multi-purpose — great for keys, watches, jewelry, remotes, or glasses Water-resistant surface makes it easy to wipe clean Adds a decorative touch while being practical Makes a thoughtful and stylish gift Cons: The sides are a little low, so bulkier items may slide out Only available in limited colors compared to some other organizers Overall, this is a really nice valet tray. It looks more expensive than it is, keeps my essentials in one place, and adds a clean, organized look to my space. Definitely worth it if you like the leather aesthetic!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 20, 2025
R
Rainstorm
Los Angeles, US
★★★★★ 5
Fits many trinkets and looks good
Color: Black
Simple little organizer for trinkets. Easy to snap together into a box shape and holds keys, pens, vapes, and other bits and pieces. My partner is happy I ordered it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 4, 2025
R
R
Pawtucket, US
★★★★★ 4
Excellent one
Color: Black, Color: Black
Build These valet trays are perfect for placements on nightstands, sofas, end tables, etc. They are very compact and unobtrusive. Their size is ideal for holding daily essentials without taking up excessive space, and blending seamlessly with various decor styles. Material Constructed with a soft and durable synthetic surface, the tray is gentle to the touch and provides a wipeable and easy to clearn finish. The black color complements any decor and the materials prevent damage to surfaces they are put on. Functionality These trays serve as excellent catch-alls for remotes, phones, earbuds, glasses, jewelry, watches and other small items, helping keep sofas, nightstands and tables organized and clutter-free. The sturdy, level construction ensures stability, and the trays hold essentials like phones, TV remotes, and personal accessories effectively. Value for Money (VFM) Given their functionality, design, and affordability, these valet trays offer good value. They enhance organization without compromising style and are suitable for various rooms in the home. Will definitely recommend them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2025
B
Verified Purchase
bratton423
Battle Creek, US
★★★★★ 5
Stylish and Practical Organization!
Color: Blue, Size: Rectangle
The CASIRENA Faux Leather Valet Tray Organizer is a game-changer for staying organized in style. This catch-all tray is not just functional; it's a sleek and elegant addition to any space. Designed with a keen eye for detail, the faux leather exudes sophistication while the thoughtful compartments provide a designated spot for all your essentials – from keys to wallets. It's perfect for an entryway table or wall, offering quick access to everyday items. The attention to quality is evident in the craftsmanship. The tray is durable and well-constructed, ensuring it stands the test of time. The blend of utility and aesthetics is truly commendable. Say goodbye to misplaced keys and cluttered surfaces. The CASIRENA Valet Tray Organizer brings a touch of organization to your life while elevating your décor. It's a practical piece of art you'll wonder how you lived without.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 22, 2023

recommand products

SUMMER DREAMER Detangling Conditioner Bar
14.19
Barrel Feet
19.99
Handmade Positive Game Controller
11.95
PURE Hydrating Solid Shampoo
269.71
Handmade Thank You For Helping Me Grow Sunflower
10.00