SKU: 7038152768

Mouse IL-13 Protein, His tag

Sale price$130.50 Regular price$145.00
Save 10%

Pay in installments of $36.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IL-13 Protein, His tagProduct Specification Species Mouse Synonyms Interleukin 13, T cell activation protein P600, Il13 Accession P20109 Amino Acid Sequence Protein sequence (P20109, Ala19 Phe131, with N His tag) APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF Expression System HEK293 Molecular Weight Predicted MW: 14. 6 kDa Observed MW: 15 33 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Synonyms Interleukin-13, T-cell activation protein P600, Il13
Accession P20109
Amino Acid Sequence

Protein sequence (P20109, Ala19-Phe131, with N-His tag) APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Expression System HEK293
Molecular Weight Predicted MW: 14.6 kDa Observed MW: 15-33 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin 13 (IL-13) is a protein that in humans is encoded by the IL13 gene. The secondary structural features of IL-13 are similar to that of Interleukin 4 (IL-4); however it only has 25% sequence identity to IL-4 and is capable of IL-4 independent signaling. IL-13 is a cytokine secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. Interleukin-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. It is a mediator of allergic inflammation and different diseases including asthma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 7038152768

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cori W
Port Orchard, US
★★★★★ 5
Almost too accurate
Format: Kindle
Another absolutely amazing book in the series, it was scary how exactly on point the actions of various agencies and governments was in this book. It would all play out like this too, absolute chaos for short term gains that in the grand scheme of things mean nothing - almost felt like I was reading "Don't look up" but with gold and silver rankers. As much as I didn't like a certain character and his family, he came through and his private chat brought a tear to my eye. Great job as always, the characters are phenomenal, but like Jason - I'm really ready to be done with Earth, what a dumpster fire.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2022
B
Verified Purchase
B
Chelsea, US
★★★★★ 4
One Step Too Far But Otherwise Great
Format: Kindle
Huge fan of this series and the multiverse that it has created. I often find find myself laughing out loud at the irreverent main characters quips. I've been five stars all the way for every book so far but I had to drop a star for a very specific reason. This was the first time I was negatively pulled out of the reading experience in this series. (Though, definitely not the first time lol. That totally random, albeit delicious, recipe for lemonade pulled me out that one rime but it wasn't an unpleasant experience). Spoilers follow: Jason's final words to his dead brother's spirit were so inappropriate and crass that I very much hope this isn't the direction that Jason's character is growing toward. I outwardly cringed and had to put the book down for a few days because I wasn't sure this was a character I wanted to continue to read about after reading those lines. Aside from that it was a great book. I truly hope this was a one-off and simply poorly written vs something we can expect more of going forward. Cringe humor can be funny but there's a limit that was drastically overstepped in that line.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
D
Verified Purchase
Deb STL
Alexandria, US
★★★★★ 5
Loved it!
Format: Kindle
There seems to be many books out there now with the fake girlfriend/boyfriend, fake girlfriend/girlfriend, or fake fiance/spouse. I actually like this particular trope quite a lot. Some are OK, bad or good. This novel falls in the last category. I really liked this book and will definitely be re-reading it sometime in the future. Tansy and Gemma are very likeable as individuals. As a couple, they have amazing chemistry very early on. One of the best things I liked about this novel is that the author doesn't make us wait until the end of the book for the characters to acknowledge their attraction. They become a true couple early on despite almost everyone thinking it is not real. The writing is well done and I really really liked the main characters. (Have I said that enough times?) There was definitely some heat too! Everything THIS woman is looking for from a romance novel. Definitely recommend. I give it 4 ¾ stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2023
J
Verified Purchase
Jazelle
Grantham, US
★★★★★ 4
I'm a Total Goner
Format: Kindle
🦇 The Fiancée Farce Book Review 🦇 Rating: ⭐⭐⭐⭐ ❝ She was a total goner. Whatever magic Tansy was made of, Gemma wanted to drown in it, revel in the honeyed heat burning her up from the inside out. It was better than the finest bourbon she’d ever had the pleasure of sipping. ❞ 🦇 After losing her parents and a traumatic romantic experience as a teen, Tansy Adams focuses all her time and energy on her late father's bookstore. To dodge questions about her love life, Tansy invents Gemma, a fake girlfriend inspired by the stunning cover model on a best-selling romance book. She never expected that real-life Gemma would step into her life, play along, and announce they were engaged, imploding that white lie into a full-on farce. Gemma van Dalen, the outcast of her wealthy family, needs a spouse to inherit Van Dalen Publishing; her grandmother's legacy. In exchange for Tansy's hand in marriage, Gemma offers to save Tansy's beloved bookstore before it's sold off. Can their marriage of convenience work, or will Gemma's scheming family get between them? ❝ "As for feeling like you’ve failed, well, failure is an inescapable part of life. But failing doesn’t make you a failure. And I’m sorry your father made you feel like the two were synonymous. You are more than your achievements, Gemma. You are brilliant, and ambitious, and you are good, do you hear me? And what you do or do not achieve in this life has no bearing on your value.” ❞ 💜 Oh. My. Goddess. That's right: goddess, because that's exactly what these two cunning, sassy women are. Alexandria Bellefleur has taken the generally predictable "marriage of convenience" trope and turned it into an emotional, powerful story about finding the love you don't realize you deserve. Both Tansy and Gemma are full of so much pain, their family trees full of broken branches (and in Gemma's case, poisonous barbs). For them to find love and family in one another so unexpectedly (for them, at least, because, come on, that's what we're here for), so flawlessly...it's not only swoon-worthy and sweet, but a relief. It's the insane, instant, undeniable chemistry between Tansy and Gemma that empowers their every interaction from the start, but unlike other marriage-of-convenience stories, smut doesn't drive their relationship. What starts off as a business relationship blossoms from a friendship to a true partnership. Gemma is sweet and giving as she navigates her first real relationship, while Tansy comes out of her shell to defend Gemma when no one else has. These goddesses support one another, even when the relationship is only a farce, until it all becomes real. The character development between them both is a flawless example of how empowering love--and having someone by your side--can really be. 🦇 As much as I loved every interaction between Gemma and Tansy, it's difficult to love everything that happens outside of their sweet sapphic bubble. The toxic men--namely Tucker, Gemma's cousin, who manipulated teenage Tansy and shared underage nudes of her--seem unrealistically cruel. Tansy's step-mother goes from a social ladder-climbing step-Bridzilla to suddenly sympathetic. None of the secondary characters have real layers, making them no more than pawns to the story's plot progression. Because of that, none of the conflicts or twists are surprising. The boardroom scene/resolution seemed beyond unrealistic, regardless of how sweet the gesture was. You may need to expand your suspension of disbelief and focus on the sapphic sweetness for this one. 🦇 Recommended for fans of Stars Collide, Cleat Cute, and Love at First Set. This heartwarming sapphic romance is full of feels; a stunning addition to any shelf. ✨ The Vibes ✨ 🩷 Fake Dating 🩷 Marriage of Convenience 🩷 Bi MCs (Bi4Bi) 🩷 Sapphic Romance 🩷 Mental Health Rep 🩷 Opposites Attract
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 10, 2024
K
Verified Purchase
Karah Ladd
Port Orchard, US
★★★★★ 5
The BANTER 😍
Format: Kindle
Thoroughly enjoyed this book. The perfect witty, banter-laden escape, even if predictable for me, which isn’t even that part of the comfort and fun?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 9, 2025

recommand products