SKU: 70417479615

Human IL-23/IL12Bp40&IL-23Ap19, No tag&His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-23/IL12Bp40&IL-23Ap19, No tag&His tagProduct Specification Species Human Synonyms IL 12B, Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40), IL 12 subunit p40, NK cell stimulatory factor chain 2 (NKSF2), NKSF2, IL 23 subunit alpha, IL 23 A, Interleukin 23 subunit p19 (IL 23p19), SGRF Accession P29460Q9NPF7 Amino Acid Sequence Protein sequence1 (P29460, Ile23 Ser328)

Product Specification


Species Human
Synonyms IL-12B, Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40), IL-12 subunit p40, NK cell stimulatory factor chain 2 (NKSF2), NKSF2, IL-23 subunit alpha, IL-23-A, Interleukin-23 subunit p19 (IL-23p19), SGRF
Accession P29460、Q9NPF7
Amino Acid Sequence

Protein sequence1 (P29460, Ile23-Ser328) IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS; Protein sequence2 (Q9NPF7, Arg20-Pro189, with C-His tag) RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Expression System HEK293
Molecular Weight Predicted MW: 20.4 kDa(IL-23Ap19)&34.7 kDa(IL12Bp40) Observed MW: 20, 40 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin 23 (IL-23) is a heterodimeric cytokine composed of an IL-12B (IL-12p40) subunit (which is shared with IL-12) and an IL-23A (IL-23p19) subunit. IL-23 is part of the IL-12 family of cytokines. The functional receptor for IL-23 (the IL-23 receptor) consists of a heterodimer between IL-12Rβ1 and IL-23R. IL-23 is an inflammatory cytokine. It has been shown to be a key cytokine for T helper type 17 cell (Th17 cell) maintenance and expansion. IL-23 stabilises RORγt and thus enables Th17 cells to release their effector cytokines, such as IL-17, IL-21, IL-22 and GM-CSF, which mediate protection against extracellular fungi and bacteria and participate in barrier immunity. Natural killer cells also express the IL-23 receptor. IL-23 also induces proliferation of CD4 memory T cells. Besides its proinflammatory effects, IL-23 promotes angiogenesis. IL-23 imbalance and increase is associated with autoimmune diseases and cancer. Low concentrations of IL-23 support lung tumor growth whereas high concentrations inhibit proliferation of lung cancer cells. IL-23 and IL-23R were identified in serum from patients with non-small-cell lung cancer and have been proposed as prognostic serum markers. IL-23 can also promote progression of cardiovascular diseases such as atherosclerosis, hypertension, aortic dissection, cardiac hypertrophy, myocardial infarction and acute cardiac injury. In brain, IL-23 is able to activate γδ T cells to increase their expression of IL-17, which contributes to the inflammatory response and thus plays a key role in secondary brain injury after spontaneous intracerebral hemorrhage.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 70417479615

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dairy Cabrales
Chelsea, US
★★★★★ 5
Very good
I like
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 6, 2025
M
Verified Purchase
Mildred Crow
Birmingham, US
★★★★★ 5
Don’t forget to take it.
It is working best that I can tell, will let you later
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2025
A
Verified Purchase
alicia
Fort Morgan, US
★★★★★ 3
No me sirvio
No cumplió para lo que fue comprado
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 9, 2023
C
Verified Purchase
CJP
Massapequa, US
★★★★★ 5
Good product
Good product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2025
H
Verified Purchase
Hunter Thomas
Birmingham, US
★★★★★ 5
High-Quality Omega 3 – Easy to Take, No Fishy Aftertaste
Size: 90 Count (Pack of 1)
I’ve been using Qunol’s Advanced Omega 3 Krill and Fish Oil Complex, and it’s one of the better omega supplements I’ve tried. The capsules are easy to swallow, and I haven’t experienced any fishy burps or aftertaste. The blend of krill and fish oil feels well-formulated, and the claim of better bioavailability makes sense since I notice benefits with fewer capsules compared to standard fish oil. I like that it combines the strengths of both krill and fish oil—EPA and DHA support heart, brain, and joint health, while the added phospholipids from krill oil may improve absorption. The softgels are also smaller and easier to take than many large fish oil pills. Pros: Combines krill and fish oil for balanced omega support No fishy aftertaste or burps Smaller, easy-to-swallow softgels Formulated for better absorption Cons: Pricier than standard fish oil supplements Bottle size could be larger for daily users Overall, this is a premium omega 3 supplement that’s worth it if you want high absorption and a cleaner experience. A reliable option for long-term heart and brain support.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2025

recommand products