SKU: 70703575348

Felis catus CD4, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Felis catus CD4, His tagProduct Specification Species Felis catus Synonyms T cell surface antigen T4 Leu 3 Accession P79355 Amino Acid Sequence Protein sequence (P79355, Met1 Thr413 (Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149), with C 10*His)

Product Specification


Species Felis catus
Synonyms T-cell surface antigen T4/Leu-3
Accession P79355
Amino Acid Sequence

Protein sequence (P79355, Met1-Thr413 (Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149), with C-10*His) MNQGAVFRHLLLVLQLVMLEAAVPQGKEVVLGKAGGTAELPCQASQKKYMTFTWRLSSQVKILESQHSSLCLTGSSKLKTRFECKKILWDQGSFPLVIKSLQIADSGIYTCEVEDKKREVELLVFGLTAKVDPSGSGGSSSTSTSTSTSTSIYLLQGQSLTLTLESPSGSNPSVQWKGPGNKSKSGVHSLSLSQLELQESGTCTCTVSQSQKTLVFNTNILVLAFRKVSNTVYAKEGEQVEFSFPLNFEDENLMGNLRWKAEGAPSSLLWISFTLKNKQLSVKEVDPYSKLQMMDSLPLRFTLPNVLSRYAGSGNLTLVLDKGQLQQEVKLVVMRVTQSGNNLTCEVLGPTSPELTLSLKLKGQAAKVSKQQKMVRVEDAEAGTWQCLLSHKDKVLLASKAEVLPPVLTRTWTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 46.8 kDa Observed MW: 50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD4 (cluster of differentiation 4) is a glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). CD4 is found on the surface of immune cells such as T helper cells, monocytes, macrophages, and dendritic cells. CD4+ T helper cells are white blood cells that are an essential part of the immune system. They are called helper cells because one of their main roles is to send signals to other types of immune cells, including CD8 killer cells, which then destroy the infectious particle. If CD4 cells become depleted, the body is left vulnerable to a wide range of infections that it would otherwise have been able to fight. CD4 continues to be expressed in most neoplasms derived from T helper cells. The antigen has also been associated with a number of autoimmune diseases such as type I diabetes mellitus.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 70703575348

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Steve
Carnegie, US
★★★★★ 3
I design flaw caused me to return it.
Color: Brown/Blue
Pros: - Perfect case size. - Sapphire crystal. - Solar powered quartz. - Large dial face - Minute and second hands reach to minute track for precise reading. - Great field watch design and proportions. - Effective lume on hands. Cons: - Lume on small triangular hour markers is useless, and fades quickly. - The hour numbers are not luminous. - The dull peach color chosen for the hour markers, numbers and hands in dim lighting is very dull and thus hard to read. - The dark blue color chosen for the dial is a dull hue that doesn’t really look blue, but just reduces the contrast between text and markers. - A black dial and bright white markers and numbers would make the watch much more legible/ readable, and would look much better aesthetically. It is a shame that these choices were made on an otherwise perfect design. - I was really excited that Timex finally seemed to get it when they came out with this series of models, but then they handicapped it with a dial that is only useable in bright light. What a shame. I am returning the watch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 23, 2022
G
Verified Purchase
Grace B.
San Leandro, US
★★★★★ 5
Great Watch!
Color: Black/Silver-Tone
I bought this watch after the resin strap on my old Armitron watch broke. I was disappointed to find that armitron doesn't make my old watch anymore, so I had to find a replacement. I did extensive research and finally settled on this watch. I needed a rugged, waterproof, backlit, time-and-date + day of week watch. I also needed a watch with a durable strap, because the resin strap sport watches only last 2 or 3 years, which is how long I had my old one. I love the mid-size design of this watch. It fits well and looks really cool. I bought a used like-new one because it was cheaper and it arrived in perfect condition, just without the instructions or original packaging. It is easy to set, easy to read, and the backlighting is just the right brightness. Setting it accurately is tricky, but I've developed my own system to only be one second off, if that. The band is slightly itchy, but it should break in. Overall, I love my new watch and I'm happy that I found something that can take a beating and still work!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2026
R
Verified Purchase
RJ
Lake Worth, US
★★★★★ 5
Quality watch at a reasonable price
Color: Black/Red
Velcro-closure on the tough fabric band is comfortable and very secure. This beautiful sports watch allows for 12 or 24-hour timekeeping, and is easy to set. Wearers can program 2 entirety different times using the "Time1" and "Time 2" settings, very useful for travel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
B
Verified Purchase
B.J.M. Indy
Chelsea, US
★★★★★ 4
Good Watch; Bad Strap
Color: Blue/Black
The watch is like many other I've worn, Timex included, and has all the features I want in a standard watch. I like the colors which are very similar to my last Timex which I've had to abandon due to failure of the wrist band after many years of daily use and the dearth of stores which replace straps. The watch itself is reliable and works well, but I do not like the velcro strap. I have very small wrists and searched a lot before deciding on this watch with an adjustable strap unhindered by the placement of buckle and holes. However, the strap is still too big to fit me well and it is tedious to align both sides of the velcro. Also, the velcro will catch my sleeves or other parts of my clothing every now and then and is avoidable only through meticulous placment of the two sides of velcro. I myself can't replace a strap with a better one because I don't know how, but if you can and have large enough wrists, then this may be the watch for you. If the manufacture or anyone else knows where one can purchase a small wrist band where the sellers will remove the one that I now have with a new, better fitting one, I wish there were a way that you could tell me. I do wish the watch were flatter because my sleeves are hard to move back and forth over it and it's also in the way of typing on my computer as well as tucking sheets in between mattress and headboard. (I can't rate the light because I haven't yet looked for the switch, and its water resistance I can't comment upon because I have not and will not subject the watch to water.)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2024
J
Verified Purchase
jalcruces
Port Orchard, US
★★★★★ 5
Good Sport Watch
Color: Blue/Black
This is a good sport watch. I wear these to work in all sorts of conditions...and they take a beating. I have to get the unisex watches/bands as I have thick wrists for a woman and women's watchbands generally don't fit me. I can't wear the metal watch bands because when I flex my wrist they break. I can't wear the leather bands because when I sweat the band just deteriorates and falls apart. These woven bands are just perfect. I also like that it is velcro. That way you can adjust it perfectly to your wrist. I have worn these watches for nearly 15 years. It has two time functions - so that you can have regular time and maybe the time in another country. It has a split lap stop watch so that you can time each lap as well as your full run. Time, date, alarm, and hour beep if you so desire. It also has a back light which is really handy to tell time in the dark. Only problem with that is at about the year mark, the battery is so low that the light will come on, but the numbers disappear. But, well, it is what it is. Some reviewers have complained that the band is rather small fitting around the wrist. I am a woman and I bought a womans Timex once. The band was EXTREMELY small and barely fit me at all. It would come off a lot of the time because there was barely any velcro to wrap around. This watch is probably more of a unisex watch. Not a woman's per se, but not a big man's watch either. It is about in the middle. I have a 7.5" wrist and that is about as large of a wrist that this watch will fit. The women's watch that I had previously had would only fit a 7" wrist.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 24, 2014

recommand products