SKU: 71927442292

Human CD69 Protein, His tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD69 Protein, His tagProduct Specification Species Human Synonyms Early activation antigen CD69, Activation inducer molecule (AIM), BL AC P26, C type lectin domain family 2 member C, EA1, Early T cell activation antigen p60, GP32 28, Leukocyte surface antigen Leu 23, MLR 3, CLEC2C Accession Q07108 Amino Acid Sequence Protein sequence (Q07108, Ser62 Lys199, with C His tag)

Product Specification


Species Human
Synonyms Early activation antigen CD69, Activation inducer molecule (AIM), BL-AC/P26, C-type lectin domain family 2 member C, EA1, Early T-cell activation antigen p60, GP32/28, Leukocyte surface antigen Leu-23, MLR-3, CLEC2C
Accession Q07108
Amino Acid Sequence

Protein sequence (Q07108, Ser62-Lys199, with C-His tag) SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Expression System HEK293
Molecular Weight

Predicted MW: 17.7 kDa Observed MW: 20-25 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD69 (Cluster of Differentiation 69) is a human transmembrane C-Type lectin protein. It is an early activation marker that is expressed in hematopoietic stem cells, T cells, and many other cell types in the immune system. It is also implicated in T cell differentiation as well as lymphocyte retention in lymphoid organs. The activation of T lymphocytes and Natural Killer (NK) cells, both in vivo and in vitro, induces expression of CD69. This molecule, which appears to be the earliest inducible cell surface glycoprotein acquired during lymphoid activation, is involved in lymphocyte proliferation and functions as a signal-transmitting receptor in lymphocytes, including natural killer (NK) cells, and platelets.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71927442292

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jackie
West Palm Beach, US
★★★★★ 5
Amazing daily facial spray
I absolutely love this facial spray! It is so moisturizing and I use it multiple times a day. I will definitely be re-ordering!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
S
Verified Purchase
Susan R. Ventura
New York, US
★★★★★ 5
Good brand
I use all their products body wash. Body lotion, and this newest addition to my makeup routine . It gives my face a little glow after makeup has been applied. I’m
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
C
Verified Purchase
Ctlvr
Waukegan, US
★★★★★ 1
. This might as well have been water. No change in skin
A friend and influencer recommended this for my sensitive, dry skin that has rosacea. I expected my skin to feel more hydrated and see reduced redness. Neither happened. ☹️ To give a full review it is unscented which is great. But I didn’t feel or see any improvement. I used it twice a day for at least two weeks.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2025
P
Verified Purchase
patioelf
Draper, US
★★★★★ 5
68 years old and this hydrated thoroughly.
I’m 68 and take very good care of my skin. I’m not sure why but this product gives me a nice ( and lasting) boost of hydration. I don’t go in the sun after 12 pm - I have fair cool skin with minimal wrinkles but some sagging. I think my skin leans towards dry although I’m always on top of it so it looks and feel hydrated.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
R
Verified Purchase
Renee
Draper, US
★★★★★ 5
Buy!! Worked well for my eczema
Love love love this product!! It’s AMAZING for my winter skin. The consistency is thick enough to deeply moisturize and keep my skin hydrated all day long. It made my skin super clear, smooth, and healthy-looking. It also really helped clear up my eczema, especially the eczema and dry patches on my face. My dry spots became so much smoother and less irritated after using this consistently. The jar lasted me a good while, which I loved since I use moisturizer constantly. There’s no fragrance, the application is super easy, and the consistency feels sooo nice on the skin. It absorbs really well and leaves my skin feeling soft and glowy. It honestly worked so well that I didn’t even need to use primer before my makeup anymore 😭 that’s how good this product is!! I will always repurchase, especially during the winter 💕
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products