SKU: 72210474835

Human YWHAQ/14-3-3 theta Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human YWHAQ/14-3-3 theta Protein, His TagProduct Specification Species Human Synonyms 14 3 3 protein theta, 14 3 3 protein T cell, 14 3 3 protein tau, Protein HS1, YWHAQ Accession P27348 Amino Acid Sequence Protein sequence (P27348, Met1 Asn245, with C His Tag)

Product Specification


Species Human
Synonyms 14-3-3 protein theta, 14-3-3 protein T-cell, 14-3-3 protein tau, Protein HS1, YWHAQ
Accession P27348
Amino Acid Sequence

Protein sequence (P27348, Met1-Asn245, with C-His Tag) MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Expression System E.coli
Molecular Weight

Predicted MW: 29.5 kDa Observed MW: 30 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

YWHAQ, also known as 14-3-3 tau (τ), is a member of the highly conserved 14-3-3 family of phosphoserine/phosphothreonine-binding proteins. It functions as a key regulatory adapter molecule in eukaryotic cells. By binding to specific phosphorylated client proteins, YWHAQ modulates their activity, stability, subcellular localization, and participation in protein complexes. It is involved in a wide array of vital cellular processes, including signal transduction, cell cycle control, apoptosis, and metabolism. The protein plays a significant role in immune cell signaling and has been implicated in the pathogenesis of cancers and neurodegenerative diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72210474835

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Honey Bawa
Omaha, US
★★★★★ 5
Super Cozy & Stylish – My New Favorite Throw Blanket
I recently got this brown leopard print throw blanket, and it quickly became one of my favorite cozy essentials at home. The first thing that stood out to me was the trendy animal print design—it adds a bold, stylish touch to my living room and makes my couch look instantly more put together. The material is incredibly soft and plush. It has that fluffy flannel feel that’s perfect for snuggling, whether I’m watching TV, reading, or just relaxing. It’s warm without being too heavy, which makes it great for using all year round. I also really like the size (60" x 80")—it’s big enough to fully wrap around me or share when sitting on the couch. It works just as well on the bed as it does as a decorative throw. Another plus is how lightweight and easy to carry it is. I’ve even taken it along for road trips, and it’s been perfect for staying comfortable on the go. If I had to point out one small downside, it’s that lighter-colored fabrics can show wear over time if not cared for properly, so I make sure to wash it gently to keep it looking fresh. Overall, I’m really happy with this blanket. It’s the perfect mix of comfort and style, and it adds a cozy, fashionable vibe to any space. Definitely a great pick if you love soft textures and bold décor!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
B
Brandon Pittman
Lowell, US
★★★★★ 5
Soft, Warm, and Holds Up Well After Washing
We grabbed this primarily for couch lounging and it has been a regular rotation blanket since it arrived. The softness is legitimate, not the kind that feels good out of the packaging and then stiffens up after a wash or two. It has gone through the machine multiple times and both the texture and the leopard print have held up without fading or pilling. The 50 by 60 inch size is a comfortable fit for one person stretched out on the couch. It is warm without being heavy, which makes it practical across seasons rather than just winter. The print looks sharp and adds some personality to a living room without being over the top. For a throw blanket at this price, the quality is better than expected and it has earned a permanent spot on our couch. If you are looking for something soft, visually interesting, and durable enough to actually use regularly, this one delivers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
C
Canadian reviewer
Fort Morgan, US
★★★★★ 5
Pretty good blanket. Slightly larger than normal throw.
I purchased this leopard print throw blanket because you can get it in twin size and twin size is a lot more usable in not only a bed but also on a couch. Like if you have two people sitting next to each other, it's a lot easier to use the twin size than a throw size, which I feel is a little bit cramped. In addition to that, I saw in the picture that this looked almost like fur. Now when you look at it in person, you can clearly tell it's not for it's got almost like a a spotted pattern even with the spots. And while I don't know if leopards actually look like that, certainly at a distance, it feels a lot more accurate than things that are only vaguely leopard printed like the the common pink ones, as you can see here in the other variety. But certainly the Brown leopard one looks good. Plus, it is comfortable and pretty soft. It's softer on one side than another side, but only slightly and while it's rolled over and stitched at the edges, it is a single layer throughout. So it's not going to give you a ton of warmth. But I will give you some warmth, you know just enough to be nice and that means you can use it year round. So overall at this price for a twin size leopard print throw. I think this is a good deal. Well I think it could be a better deal. I've certainly seen worse so I think I could recommend this product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
M
Mona Peters
Massapequa, US
★★★★★ 5
Pink cheetah blanket
Color: Pink Leopard, Size: Throw(50" x 60")
I recently got this pink cheetah print throw blanket, and honestly, it’s such a fun and cozy addition to my space. The first thing that stood out to me was the design—the pink leopard print is super cute and adds a pop of personality to my couch without being too overwhelming. The material is really soft and lightweight, which makes it perfect for everyday use. It’s warm enough to keep me comfortable while lounging or watching TV, but not too heavy where it feels bulky. I also like that it’s easy to fold and move around, whether I’m using it in the living room or taking it to bed. Size-wise (50” x 60”), it’s a good throw size—great for one person, though if you’re looking to fully wrap up, it might feel a bit small. The quality feels decent for the price, and it seems to hold up well after use without shedding. Pros: • Super soft and cozy • Cute, trendy design • Lightweight and easy to use • Good value for the price Cons: • Slightly small if you want full coverage • Not the thickest blanket for colder nights Overall, I’d definitely recommend it if you’re looking for something stylish, comfy, and affordable to decorate your space while staying cozy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
R
Verified Purchase
Rusty Shakleford
Natrona Heights, US
★★★★★ 5
This is a fabulous LIGHTWEIGHT blanket exactly as advertised!
This blanket is exactly as described, it is LIGHTWEIGHT meaning it is thinner and cooler than some of the other Berkshire lines of thicker heavier blankets. I have purchased at least 20 Berkshire blankets/throws for myself and for gifts because they are the absolute best quality at a seriously reasonable price. They are so soft and comfy and they will survive years of regular use and washing. This one is a gorgeous deep purple and is the perfect weight for our recent 85+ degree days in March with nights that still need more than a sheet but less than a comforter. It measures true to size after a thorough wash/dry cycle and I have had zero shedding issues so I’m not sure what other buyers are doing but please wash your blankets before using them. The photos show this gorgeous purple in a twin size next to a twin “Ombré Burgundy classic heavyweight” (omg go check that one out) and you can see the purple one is just about half the thickness of the other one which is exactly what I wanted for the hotter summer months coming up. If you want a thicker blanket, Berkshire makes a lot of them, just look for the ones marked “HEAVYWEIGHT” instead of going through the hassle of returning a blanket that is clearly advertised as a “lightweight soft fuzzy plush blanket or throw” and then getting mad because you got a lightweight soft fuzzy plush blanket or throw 🤣
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026

recommand products