SKU: 74711069078

FABP5 His Tag, Human

Sale price$193.50 Regular price$215.00
Save 10%

Pay in installments of $53.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP5 His Tag, HumanProduct Specification Species Human Accession Q01469 Amino Acid Sequence Ala2 Glu135, with N terminal 8*His MHHHHHHHHATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Expression System E. coli Molecular Weight 17kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution Reconstitute

Product Specification


Species Human
Accession Q01469
Amino Acid Sequence Ala2-Glu135, with N-terminal 8*His MHHHHHHHHATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Expression System E.coli
Molecular Weight 17kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 5(FABP5), epidermis is a protein encoded by the FABP5 gene. The gene encodes a fatty acid-binding protein present in epidermal cells and was first identified as being upregulated in psoriatic tissue. Fatty acid binding proteins are a small, highly conserved family of cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. The effects of FABPs are thought to include fatty acid uptake, transport and metabolism. FABP5 has been shown to interact with S100A7.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 74711069078

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
RaeC
Grantham, US
★★★★★ 4
Warm Hands for Experienced Snow Machine Riders
Durable, lightweight, comfortable, and warm (my sled has heated handlebars). Gauntlets hold their shape very well. Easy to get hands in and out. Clear screen fogs up on the inside, so you can't see through it. I recommend for experienced riders who know where all of the buttons are. After getting a few good rides with a swithbox gremlin I would be comfortable using them again. Will also need to reposition OFF BUTTON. Gauntlet fabric at handlebars is a little flimsy, so putting hands in and out may accidentally press the button. I might add pieces of foam where gauntlets secure to handlebars to add structure and support. I had no problems on my very first ride, but I didn't test the amount of pressure needed to make it press the button. I've recommended them to others in Facebook Groups. I trust the brand. Had no problem fitting hands and arms in and out with thick coat & gloves in -14°F to +36°F. All-in-all... Worth the money, but would recommend waiting for a sale.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2026
W
Verified Purchase
Walter Beck
Natrona Heights, US
★★★★★ 5
Very warm, adjustable fit
Nice fit, just used on snowmobile in Wisconsin
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
J
Verified Purchase
Jrc
Fort Morgan, US
★★★★★ 1
Protectores de manubrio para bicicleta
Se les mete el agua no son buenos
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
D
Dominic
San Leandro, US
★★★★★ 3
They're okay, but they're quite bulky.
I liked the design and overall application of these, but they don't fit my needs. They definitely work well at protecting my hands from freezing weather, but they are way too bulky for regular motorcycle use. In my opinion, I feel that these would be much more suited for a snowmobile or ATV. If you treat them as what they’re mostly designed for — ATV/snow-related riding or cold-weather utilitarian use — these gloves are a solid buy. They deliver warmth, weather protection, and decent control through the TPU windows. But if you put them on a fast street motorcycle or expect “motorcycle-glove” levels of control and feel — they’ll likely disappoint or even pose safety trade-offs. In that context, lighter and more control-oriented gloves would probably serve you better. The reason I'm docking stars is because they're marketed toward motorcycle users, and they;re very impractical. The durability seems pretty good, as I've taken them out and even had a couple of rocks/road debris hit the TPU windows with no scratches or punctures. They're not super comfortable to use at highway speeds, especially since they fit so loose, and they tend to press my front brake/clutch which is very dangerous. I personally cannot recommend this product for motorcycle use, unless you already have handguards, which will probably negate the need for these at all. Invest in some good heated gloves and/or heated grips, and I think you'll be much safer and better off in the end. For the price, I think this is a good value, but they're just not for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 11, 2025
B
Verified Purchase
Bob Cremer
Whiting, US
★★★★★ 5
All ATV owners need these.
These gloves are fabulous. Anybody having fun on a ATV need these. With my hand warmer and these gloves, I don’t wear anything else on my hands. They are great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 30, 2025

recommand products