SKU: 75375088885

IL-3 Rα/CD123 His Tag Protein, Cynomolgus

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-3 Rα/CD123 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms IL3R, IL3RA, IL 3Ra, IL 3R alpha, IL3RAY, IL3RX, IL3RY, CD123 antigen, hIL3Ra, hIL 3Ra, MGC34174, IL 3 R alpha Accession G8F3K3 1 Amino Acid Sequence Arg18 Arg302, with C terminal 8*His

Product Specification


Species Cynomolgus
Synonyms IL3R, IL3RA, IL-3Ra, IL-3R-alpha, IL3RAY, IL3RX, IL3RY, CD123 antigen, hIL3Ra, hIL-3Ra, MGC34174, IL-3 R alpha
Accession G8F3K3-1
Amino Acid Sequence

Arg18-Arg302, with C-terminal 8*His RTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSMPAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFLSCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIAPLSRGSQSSHILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYELRIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGASSRGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

50-65kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. LIU, KEQIANG, ZHU, MENGRU, HUANG, YAO, et al. CD123 and its potential clinical application in leukemias [J]. Life sciences,2015,122(1):59-64.

Background

Human IL-3 Rα is expressed from human 293 cells. It contains AA Thr19 - Arg305. This protein carries a polyhistidine tag at the C-terminus. Interleukin 3 receptor alpha (low affinity) (IL3RA), also known as CD123 (Cluster of Differentiation 123) is a 45-62kDa glycoprotein member of the hematopoietin receptor superfamily. This protein associates with a beta subunit common to the receptors for IL-5 and granulocyte-macrophage colony-stimulating factor (GM-CSF) to form a high-affinity receptor for IL-3. The interleukin-3 receptor α chain (CD123) has been identified as a potential immunotherapeutic target because it is overexpressed in AML compared with normal hematopoietic stem cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 75375088885

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jaime R.
Natrona Heights, US
★★★★★ 5
Absolutely Perfect?!!
Size: 15 Combo Travel Size, Size: 15 Combo Travel Size
AMAZING!! This made packing soooo easy and such a breeze!! My suitcase was organized & I had everything that I needed for my trip. It has a great suction & comes with several red strips (I’ll call them) to ensure a tight seal before suctioning the air out. The bags comes on several different sizes & hold quite a bit of items in the big bag which held out hoodies & sweatsuits. Vacuum it’s not loud at all. Lightweight but packs power. This is a game changer! Very durable & great quality!! I’d highly recommend this item.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
J
Verified Purchase
Jeff Stokes
Lake Worth, US
★★★★★ 3
Good Space Savings, but the Bag Zippers don't hold very well
Size: 15 Combo Travel Size
I purchased these Vacbird travel vacuum bags mainly to save space in carry-on luggage and cruise packing, and the overall concept works well. The included rechargeable air pump is compact and convenient for travel, and the compression bags can significantly reduce the amount of space taken up by clothing and soft items when sealed properly. The bags themselves are easy to fill and compress, and they can definitely help organize luggage more efficiently for longer trips. For bulky clothing like jackets, sweatshirts, or extra layers, the space savings are noticeable. The rechargeable pump is also more convenient than manually rolling air out of the bags repeatedly. The reason this isn’t a higher rating is the zipper closure quality. The zippers feel much weaker than they should for a product designed around repeated compression and travel handling. Several closures required extra care to avoid separating or leaking air, which reduces confidence in long-term durability. The system works, but the zipper design feels like the weak point and keeps the product from feeling as reliable as it otherwise could be.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
B
Verified Purchase
Bri
Louisville, US
★★★★★ 5
Amazing product, and even more AMAZING Customer Care Team!
Color: All Black Premium Gift Box, Size: Z1 Motor + Batteries, Color: All Black Premium Gift Box, Size: Z1 Motor + Batteries
I don't normally write reviews, however I can't not mention the ABSOLUTELY AMAZING Customer Care experience I had with these folks. But first, In review of the product itself, which is the 'Executive Series Black Milk Frother with Black Holster Stand'. This is my first 'frother' purchase, and I must say I was skeptical at best to try it, but I opted to purchase it anyway because of all the great things the company stands for. I figured, how good could it really work?! Well, as a matter of fact, it worked quite wonderfully! Within just a few seconds / pulses of the frother, you have beautifully frothed contents. It is simple to operate, with one hand, and just the simple push of a button. (I imagine I could even make whipped cream without dragging out a stand mixer.) The batteries, (2 AA - not included), were simple to load. And, there is a battery pull ribbon so you can also remove them easier, if you utilize the pull ribbon and thread it between the batteries. This device quickly became part of my weekend coffee routine, and I also purchased a lesser model to bring to work. (This 'Executive' one, has a holster stand, which looks nicer, and seemed to cradle the frother, instead of hooking it into the holder.) I was so happy with the frother, I was sad that one day it seemed to not be working quite as well. I thought .. hmm, maybe the batteries need to be changed? I changed the batteries, and was still experiencing it not really working. (I would press the button, but it didn't start frothing right away, and then seemed less powerful in a way when it did start. But, it did still froth.) After a second day of experiencing the same thing, I reached out to Zulay. They are gracious enough to have ALL of their contact information printed directly on their box, underneath all of the beautiful information about the company, and where / how it began. It was on a weekend, so I chose to send an email describing what I was experiencing, and asking their advice. Based off most recent attempts at Customer 'Service' with other companies, I didn't really expect to hear back. Not only DID I hear back, but I received an email from a human, not just a system-generated response with canned information. They expressed their concern for my item not working, and assured me they would make it right if given the opportunity. They wanted to confirm my order, to make sure they had the same model in stock. Within hours, they sent me a link to replace my item, and would ship it directly to me, no questions asked. No need to return the inoperable item, no need to do anything but literally click the button and wait for it to arrive. My replacement arrived, and it was the exact model I purchased. It was brand new, wrapped in package .. not some refurbished item. And, much to my shock and appreciation that almost NO ONE does this anymore, there was a hand written card included in the package thanking me for giving their family run business a shot. Well, I thank YOU for sharing YOUR family with us, and for making me feel a little like a piece of yours! I would highly recommend this product, and would certainly purchase it, or others, in the future. I would certainly also be comfortable gifting this item. Enjoy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2024
S
Verified Purchase
Supercommuter
Houston, US
★★★★★ 5
Easy and a good price
Color: Absolute Black, Size: Z1 Motor + Batteries
Such a handy and effortless way to quickly blend supplements. A great reasonable price for this tool makes it an easy choice. Works beautifully and easy to keep clean. Treat is with care to make it last.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
M
Verified Purchase
MARY
Lake Worth, US
★★★★★ 5
Changed 1st review. Product works well!
Color: Absolute Black, Size: Z1 Motor + Batteries
Need to change my review. I WAS putting the batteries in wrong. 🫤 My husband showed me what I was doing wrong. Apologies for the first review. Doesn't work. I put in the batteries three different times just to make sure I wasn't making a mistake, but it wouldn't turn on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026

recommand products