SKU: 75896981631

Human DKK-1, His tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human DKK-1, His tagProduct Specification Species Human Synonyms Dickkopf related protein 1, Dickkopf 1, Hdkk 1, SK Accession O94907 Amino Acid Sequence Protein sequence(O94907, Thr32 His266, with C 10*His) TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRHGGGGSHHHHHHHHHH Expression System

Product Specification


Species Human
Synonyms Dickkopf-related protein 1, Dickkopf-1, Hdkk-1, SK
Accession O94907
Amino Acid Sequence

Protein sequence(O94907, Thr32-His266, with C-10*His) TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRHGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 27.4kDa Actual: 45kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied. 

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.

Background

DKK-1 is a member of the dickkopf family and is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the Wnt signaling pathway. DKK-1 is an antagonist of the Wnt/β-catenin signalling pathway that acts by isolating the LRP6 co-receptor so that it cannot aid in activating the WNT signaling pathway. Moreover, DKK-1 was demonstrated to antagonize the Wnt/β-catenin pathway via a reduction in β-catenin and an increase in OCT4 expression.This inhibition plays a key role in heart, head and forelimb development during anterior morphogenesis of the embryo. Elevated levels of DKK-1 in bone marrow, plasma and peripheral blood are associated with the presence of osteolytic bone lesions in patients with multiple myeloma. Due to the role of DKK-1 in inflammation induced bone loss DKK-1 is under investigation as target for therapeutic strategies in medicine and dentistry.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 75896981631

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sam
Alexandria, US
★★★★★ 5
Almost a year after purchase and this printer has not let me down!
Color: Black, Style: ET-2800-B, Pattern Name: Printer
I wanted to wait to write a review on this printer to see how it held up over time. Happy to report, after almost a year, it is still working perfectly! I was very nervous about purchasing a printer since it was my first time having to shop for one and almost every printer I looked at had something negative to say about the product. After extensive research, I decided to take a leap with the Epson EcoTank 2800. I was looking for a printer to use for recreational use. Something with decent print quality and longevity as well as something on a reasonable budget. I normally print full pages of color and have been using it regularly for around a year and I have about half of the ink that came with the printer left. Safe to say, the ink lasts a while. The quality may not be the top of the line quality you can get with a more expensive printer, but for the price and just everyday use, the quality is satisfactory. It was easy to set up and walked you through the instructions to connect to devices and configure it. The screen is a little small but if you can overlook that, it really is a nice printer. I have used regular printer paper, card stock, and sticker paper with this printer and I try to load only a few sheets at a time to avoid a jam but I haven't had any issues with it so far. Overall, I am extremely happy with my purchase. It can be extremely difficult to find a decent printer and some reviews can be misleading or leave you with questions on if the product is for you. If you are looking for something for printing everyday with decent quality and ink consumption that won't cost you a fortune, this printer is definitely worth taking a chance on!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
S
Verified Purchase
Scott
Charlottesville, US
★★★★★ 4
Printing is great, wifi is a problem (I figured out how to make it work!)
Color: White, Style: ET-2800-W, Pattern Name: Printer
I was on the fence about buying this printer because most of the 1 star reviews all said the same thing... "The Wifi would not work" So I followed the instructions, Turned on the print, downloaded the IOS app, connected to the printer via Bluetooth, installed the ink, initialized the printheads. While that was going on, the app asked me to setup the wifi. a List of SSID's came up and I selected the one I wanted. I put in the password and it connected and the icon on the printer turned blue. I have a Unifi setup and I could see that the printer connected to access point #3 @ 2.4ghz and got an ip address. I locked the IP address to the printer. (For my instructions to work for you, you need to make a reservation or lock the ipaddress that your DHCP server provided to the printer. ) If you don't do this, you will get a different address every time you turn the printer on and the computer and app will not be able to find the printer. When the initialization was complete, the app on my phone said it could not connect to the printer. I decided to try to connect to a computer and come back to the phone app. I downloaded the software package from Epson and ran it. When it went to connect to the printer it could not find it and brings up a list of troubleshooting steps that are not likely to do anything. There are videos about this problem and they are all useless. I am an IT professional with 26 years of experience. I am not going to unplug the printer and wait five minutes, I am not going to re-boot my router, I have a Unifi network environment with over 150 devices connected... (I have great wifi coverage, I am not moving my printer anywhere) My network works just fine, this printer is the issue! So at this point, I know that the printer IS connected to my wifi and it got an IP address. This is not a wifi problem as everyone seems to think it is. It is an issue with the Epson software. I decided to try to install it via the windows printer installer. I selected install via TCP/IP and put the ipaddress that my Unifi system provided to the printer. Windows found the printer and since the Epson app had already installed the drivers... just asked me what drivers I wanted to use. The ET-2800 showed up on the right hand side of the screen. I selected it, it installed and I was able to try a test print. It worked fine. I can print from my computer to the printer via the network. Next was the phone app. The phone app has the option to find the printer via the IP address. I put the IP address in and it found the printer. The phone app works now too. So, It took me some time to get this working, it should not have taken any time at all if the software worked correctly. The printer is really nice, it is a shame that the software is so bad when it comes to connecting to the printer. So if you decide to buy one of these printers, save yourself the headache and just install using the ip address, it is quick and easy that way and it just works. I would have just purchased an HP printer, but I did not want to deal with all the issues of their subscription ink service. I feel like the cost of ink makes this printer worth the hassle of getting it to work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2024
S
Verified Purchase
Sinbad
Natrona Heights, US
★★★★★ 5
Premium Print Quality Meets Economic Design
Color: White, Style: ET-2803, Pattern Name: Printer
I am very impressed with the manufacturer quality of this printer. It feels durable and well-engineered. The print quality is equally excellent; colors are vibrant and text is sharp, easily meeting the standards I need for both documents and photos. Moving away from cartridges is a huge win. The ink lasts incredibly long, and the refill process is clean and simple. The only thing I miss is a USB port for printing directly from external storage. My old HP printer had this feature, and it was extremely useful for printing files quickly without a computer. I wish this Epson model included that same convenience. Final Verdict A high-quality, reliable printer that produces great results. If you don't mind the lack of a direct USB drive slot, it’s an outstanding choice for home use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
H
Verified Purchase
Hawk R.
San Leandro, US
★★★★★ 5
Handles Photo-Quality Prints, Versatile Connectivity
Color: Black, Style: ET-2800-B, Pattern Name: Printer, Color: Black, Style: ET-2800-B, Pattern Name: Printer
I've had this printer for a whole year now. I was on a severe budget, looking for a photo-quality printer that didn't require Wifi in this digital age- because I quite frankly can't afford my own Wifi connection. My rink-a-dink laptop had to be set up with the software at my library, and an extra cord purchased. All that said, I mostly print from my phone, because the software app is a bit easier to ensure that I get the highest quality setting. Laptop loves to be a snot about it. The blutooth feature, or "wifi direct", has a way about it, and as soon as you figure out what it wants, it gives minimal problems. It functions exactly as if a printer had wifi on it, believe it or not. What sold me on this model was the ability to do all of that, and adjust for different situations, seeing as other brands DEMAND constant wifi connectivity (lookin' at BROTHER, maybe Canon, too), and the long lasting ink tanks- I've printed hundreds of pages, and being a gothic/horror artist, at least a good part of the time, black is the only color even half gone. What horrified me the most about printer-shoping dropping a lot of money (hundred plus is a lot over here, man) and not getting the prints to look like my work. Well, fear not. The attached pictures are why I made this review, to hopefully ease the anxiety of others. I make digital paintings, and use high DPI for high quality, and also the cutest micro-stickers you've ever seen. Prints come out clear, even if they can sit in the tip of my finger. Yes, there are probably better printers. Maybe they're faster, and have even better connectivity, and have more bells and whistles. I specifically did not want to pay for those things, so, I'm very happy there's options. It's not perfect, no, because every now and then, I get what I call a "special edition", where my printer has decided to multi-color barf out the last third of the page. One time it randomly printed in black and white. Well, that's no big deal, my stuff tends to look great in monochrome. Every now and then I get a low quality print; things just look a bit fuzzy. I'm not happy about that, but, you clean the heads, and print something simple and toony, and it has never done it twice in a row. Alignment has been off only one time, and I put the printer away after every session. It occurs to me that people pay good amounts of money for printers that do that sort of thing anyway, so... Printers gonna printer, no matter where you try to hide. Overall, I'm happy and relieved. I hope it lasts me a good long time. (Streetratt on Kofi, by the way.🖤 )
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
D
Verified Purchase
Duck One
Belleville, US
★★★★★ 5
Great functional printer
Color: Black, Style: ET-2800-B, Pattern Name: Printer
This is a great basic printer for my office. We have a higher model in our main floor office but it is older. The setup is fast and easy and it prints well. I set it up right from my phone. The picture quality is great and it prints quickly. It is so convenient and was the right price for what I need.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026

recommand products