SKU: 77020620833

Human NKX6.1, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NKX6.1, His tagProduct Specification Species Human Synonyms Homeobox protein NK 6 homolog A Accession P78426 Amino Acid Sequence Protein sequence(P78426, Met1 Pro48&Thr66 Pro120&Pro179 Arg240, with C 10*His) MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPGGSGGSTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASPGGSGGSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 19. 4kDa

Product Specification


Species Human
Synonyms Homeobox protein NK-6 homolog A
Accession P78426
Amino Acid Sequence

Protein sequence(P78426, Met1-Pro48&Thr66-Pro120&Pro179-Arg240, with C-10*His)
MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPGGSGGSTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASPGGSGGSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 19.4kDa Actual: 20-35kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Homeobox protein NKX6.1 is a transcription factor (TF) that plays a critical role in pancreatic β cell function and proliferation. In human pancreatic islet, NKX6.1 expression is exclusive to β cells and is undetectable in other islet cells. As a Transcription factor, NKX6.1 binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in the development of insulin-producing beta cells in the islets of Langerhans at the secondary transition. Together with NKX2-2 and IRX3 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 77020620833

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Ryan Miles
Draper, US
★★★★★ 5
Clean Look, Super Comfortable – Instantly a Favorite
Size: 9.5, Color: White Leather
These sneakers are exactly what I was looking for—sleek, minimal, and incredibly comfortable right out of the box. The white leather looks sharp and pairs easily with everything from jeans to chinos, even dressed-down office wear. What surprised me most was the comfort. The sole is lightweight with just the right amount of cushioning, making them perfect for walking around all day. I’ve worn them on long city days and never felt sore or tired. They fit true to size (I’m a 9.5 and they’re spot on), and the quality feels premium. If you're after a versatile white sneaker that balances style and comfort, these are 100% worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2025
A
Verified Purchase
Alain
Draper, US
★★★★★ 5
Comfortable
Size: 10.5 Wide, Color: Black Leather/Black
Very comfortable shoes, you feel like walking on clouds
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
G
Verified Purchase
Gene and Karen
New York, US
★★★★★ 3
Not for all surfaces.
Size: 11.5 Wide, Color: Black Leather/Optic White
The sneakers look great and are comfortable on flat, smooth surfaces. Warning: The sole is very flexible and not well cushioned so a walk on rough or uneven surfaces can become uncomfortable quickly. Just understand the limitations.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
E
Verified Purchase
Eduardo Renta
New York, US
★★★★★ 5
⭐⭐⭐⭐⭐ Clean Look, Comfortable Ride
Size: 11.5 Wide, Color: Woodbury Handstain
The Cole Haan Men’s GrandPro Tennis sneakers are a perfect mix of laid-back and polished — the kind of shoe you can wear everywhere without thinking too hard about it. Right off the bat, the design is subtle but refined. They’re minimalist enough to pair with jeans and a hoodie, but they also work with chinos and a button-down for a more put-together look. The “tennis” aesthetic keeps it classic without feeling like you’re wearing athletic shoes. Comfort is where these really shine. They’re lightweight and cushioned in all the right places, so long walks, errands, or standing around at events don’t end with sore feet. There’s no stiff break-in period — they feel good from the first wear. The sole has just the right balance of support and flexibility, which makes them easy to wear all day. The materials feel good too — soft, sturdy, and not flimsy. They hold up well after repeated wear and still look fresh even after a few outings. They don’t crease or scuff up excessively, which is always nice. If I had to point out a downside, it’s that they’re not performance sneakers for athletics — but that’s not what they’re meant to be. They’re lifestyle shoes that look great and feel great for everyday wear. Overall, a solid go-to sneaker that elevates casual outfits and keeps comfort front and center. Easy recommend if you want versatile kicks that stay stylish without being loud. I was able to pick up this particular pair here on Amazon for 50 bucks, 56 total with everything and honestly I’m still scratching my head in that deal. I mean my New Balance were 70 bucks or something like that. These are brown leather, sophisticated and comfortable, just amazing shoes. I get compliments all the time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2026
D
Verified Purchase
Deborah Barnum
Lake Worth, US
★★★★★ 5
Quality and Comfort
Size: 12, Color: White
My husband is a Cole Haan shoe person and what we love mostly is the comfort and quality and style.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026

recommand products