SKU: 78373514040

Human CD47, His tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD47, His tagProduct Specification Species Human Synonyms Antigenic surface determinant protein OA3, Integrin associated protein (IAP), Protein MER6 Accession Q08722 Amino Acid Sequence Protein sequence(Q08722, Gln19 Glu141, with C 10*His) QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 15. 6kDa Actual: 30 45kDa Purity

Product Specification


Species Human
Synonyms Antigenic surface determinant protein OA3, Integrin-associated protein (IAP), Protein MER6
Accession Q08722
Amino Acid Sequence

Protein sequence(Q08722, Gln19-Glu141, with C-10*His) QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:15.6kDa Actual:30-45kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD47 (Cluster of Differentiation 47) also known as integrin associated protein (IAP) is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 belongs to the immunoglobulin superfamily[5] and partners with membrane integrins and also binds the ligands thrombospondin-1 (TSP-1) and signal-regulatory protein alpha (SIRPα). CD-47 acts as a don't eat me signal to macrophages of the immune system which has made it a potential therapeutic target in some cancers, and more recently, for the treatment of pulmonary fibrosis. CD47 is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. Furthermore, it plays a key role in immune and angiogenic responses. CD47 is ubiquitously expressed in human cells and has been found to be overexpressed in many different tumor cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78373514040

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LA Living
Lexington, US
★★★★★ 5
Wonderful chair
Color: Dark Black
I bought this office chair as a sewing tool, you might say. I felt that having an office chair on wheels would get me from the sewing machine to the ironing board and then to the cutting board and back to the sewing machine. I was having to get up and down to get around to all these places before and this saves me so much time and effort. I’m 71 so when the box came I was hesitant to try to bust into it and put it together but it went together so easily. It’s very comfortable and the lumbar support feels great on my low back. When I first sat down after the assembly process, the chair cushion tipped down in the front but after contacting the support team I was advised to tighten the tilt tension located under the chair and that fixed me right up! All and all, my chair is the perfect addition to my sewing area at a very affordable price. I couldn’t be happier!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2024
S
Verified Purchase
SP
Chelsea, US
★★★★★ 4
Comfortable, affordable, and great for small spaces!
Color: Light Purple, Color: Light Purple
I had previously left a review of two stars, but have since deleted that review after I've owned the chair for a few weeks now. Initially, I stated the chair was uncomfortable and not cushioned at all. But this issue quickly resolved after sitting it for a longer time, it seems the cushion molds to you. So it may be uncomfortable the first few times sitting on it, but it eventually softens. The cushion is now soft yet sturdy. You don't sink in too much, but it's comfortable for sitting for long periods of time. I personally enjoy the mesh back as well, it supports my lower back and doesn't cause back pain. Normally I have to use a cushion of my own to support my lower back for most chairs, but this one actually supports me in a way that doesn't require an extra cushion - so that's really nice. The chair is fairly on the smaller end, which is perfect for low desks or tight spaces, which is exactly what I wanted. The height can be adjusted, but even at the highest setting, it is still fairly low. Keep that in mind - it may not be super comfortable for those over 6 ft. The arms flip up which makes storing it under a low desk very easy. The cushion is thick and very accurate to the picture. I love that it is lightweight and doesn't make much noise when rolling the chair. It also feels very sturdy. Some of the reviews say it feels flimsy, and I don't know if some are just assembling it incorrectly, because for me this thing is very strong and holds up quite nicely under my weight. Overall, this is exactly what I wanted for my personal living space. A chair that's not too bulky, but comfortable enough to sit in for long hours. It functions as advertised for this purpose. One final thing -- the color selection is gorgeous. I bought the light purple color and it fits my setup nicely! Color was accurate to the picture, and looks very cute and adorable in my space.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2025
C
Verified Purchase
Christine Franzone
Pawtucket, US
★★★★★ 5
Exteremly comfortable
Color: Dark Black
Reasonably priced, very comfortable l, easy assembly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
J
Verified Purchase
James F Evans
Los Angeles, US
★★★★★ 5
Surprisingly amazing chair!
Color: Pink, Color: Pink
tl;dr: If you need a chair that has the features of this one, then this one is a winner! Hits above its weight class for sure. My wife is 5’. She’s small. For whatever reason she ended up with a chair made for big people, like 6+ feet and up to 500lbs type of a chair. She’d often even sleep on it and chill on it. The chair was big enough to fit 2 of her to be honest. It was an expensive chair that I won at some raffle and didn’t like myself. Over the years it ripped (got a cover for it) and even started to get lopsided (from the sleeping) and finally a spring broke (hence the pillow on it in the pictures) She obviously lives pink. I also wanted to get a chair where she could work and not end ip asleep on. Not like we have a couch or a bed for that 😂. This chair is very obviously smaller than her previous chair, it’s also significantly cheaper in price and build, it’s also not as durable feeling or stable, and it’s just not as padded. Yet somehow it’s an amazing chair that we both like better than her previous chair??? Like it’s crazy that this chair somehow works better in so many ways. Her desk is modified to be shorter than normal desks (again, she small lol) and her previous chair was just too big. The wheels are also like SUPER smooth, like you can run a chair race easily with it. It rolls over her rug and tucks into her desk (which is in our bedroom) easily. The amount of space this has save us when the chair isn’t being used is a lot. Previous chair was much bigger and didn’t tuck in at all. The color is nice and the padding is plenty for a small and much lighter than 500lbs woman. I’m 6 feet and 200 lbs and the chair is nice for me as well. My chair is bigger and more secure in the backing, which is similar to this one. The lowest tension setting on my chair is still too high for her to lean back on my chair. This chair has a lower tension minimum and she can easily lean back freely, as well as keep enough tension to work without sagging. This chair is surprisingly outstanding! I’m sure my wife will destroy it quicker than the last one, but it’s so cheap that even if it only lasts 1-3 years, I’ll happily buy it ones or twice more 🤷🏽‍♀️. Maybe by then they’ll invent a comfortable titanium chair that’s affordable that she won’t destroy 😂.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2024
R
Verified Purchase
Rebecca Olmos
Massapequa, US
★★★★★ 3
Mid.
Color: Light Purple
The chair is fine, and reasonably easy to put together. However, I've been using it for a little over a year and a half, and it's already falling apart. Random parts of it have fallen off, which is fine because it was still functional. But now the most frustrating part is that the wheels continue to pop off, and while the first attempts to pop them back on worked, they will not stay on now. This is obviously greatly impacting the stability, and I will need to purchase a replacement soon. For this price and lack of long-term durability, I would not buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026

recommand products