SKU: 78728017620

Mouse CD62L, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD62L, his tagProduct Specification Species Mouse Synonyms CD62 antigen like family member L, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, Lymphocyte antigen 22 (Ly 22), Lymphocyte surface MEL 14 antigen, Lnhr, Ly 22, Ly22 Accession P18337 Amino Acid Sequence Protein sequence (P18337, Trp39 Asn332, with C 10*His)

Product Specification


Species Mouse
Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, Lymphocyte antigen 22 (Ly-22), Lymphocyte surface MEL-14 antigen, Lnhr, Ly-22, Ly22
Accession P18337
Amino Acid Sequence

Protein sequence (P18337, Trp39-Asn332, with C-10*His) WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 34.8 kDa Observed MW: 50-60 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. It is coded for in the human by the SELL gene. L-selectin belongs to the selectin family of proteins, which recognize sialylated carbohydrate groups containing a Sialyl LewisX (sLeX) determinant. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. In addition to its function in the immune response, L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78728017620

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chris White
Fort Morgan, US
★★★★★ 4
Good Tool
Size: One Size, Style: Bottle Opener
This thing is great at opening bottles, and it has a Klein handle. Perfect for the electrician in your life, even if that's yourself. I had to knock off a star because the handle is not quite as good as other Klein tools. The plastic is not as clear. The TIP-IDENT bottlecap marking is off-center and not fully printed. The bottle opener sticks out at a slight angle. This does not affect the performance, but it does detract from the novelty somewhat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2023
M
Verified Purchase
Mike Lemley
Boise, US
★★★★★ 5
Great light for hard hat.
Style: 180 Lumens
These lights are perfect for our crew. They mount easily over a hard hat. Our guys are tough on them throwing them in the truck or down on the Jobsite. Very durable and offer good lighting for individual worker. Batteries will last a whole shift.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 20, 2025
T
Verified Purchase
Thundercats
Whiting, US
★★★★★ 5
Great Helmet Light
Style: 250 Lumens
Fantastic illumination which is what I need when I’m walking under ground in train tracks area the tunnels aren’t very well lit. This gives me added lighting along with my flashlight to make me feel safe plus help me watch my step.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
C
Verified Purchase
Clinton Queen
Waukegan, US
★★★★★ 5
Great product for plant workers
Style: 220 Lumens
Works great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2025
K
Verified Purchase
Karen T. Duncan
Whiting, US
★★★★★ 4
Good light. Minor flaws.
Style: 180 Lumens
Good light, only flaws is that it didn't come in a box. It was just in a clear plastic bag. And batteries were not included.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 22, 2024

recommand products