SKU: 79597640824

Human Urokinase Protein, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Urokinase Protein, His tagProduct Specification Species Human Synonyms Urokinase type plasminogen activator, U plasminogen activator, uPA, PLAU Accession P00749 Amino Acid Sequence Protein sequence (P00749, Ser21 Leu431, with C His tag)

Product Specification


Species Human
Synonyms Urokinase-type plasminogen activator, U-plasminogen activator, uPA, PLAU
Accession P00749
Amino Acid Sequence

Protein sequence (P00749, Ser21-Leu431, with C-His tag) SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Expression System HEK293
Molecular Weight Predicted MW: 48.1 kDa Observed MW: 54 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Urokinase - type plasminogen activator is a serine protease that plays a crucial role in the fibrinolytic system. It is mainly produced and secreted by various cells, such as endothelial cells and monocytes. u - PA specifically converts plasminogen into plasmin, which is capable of degrading fibrin clots and extracellular matrix proteins. This process is essential for maintaining the balance of blood coagulation and fibrinolysis, as well as for tissue remodeling and wound healing. Dysregulation of u - PA has been implicated in many pathological conditions, including thrombosis, cancer metastasis, and inflammatory diseases. Therefore, u - PA is an important target for the development of drugs to treat these diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 79597640824

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
claudia
Carnegie, US
★★★★★ 5
Easy to assemble and quality
Style: Printer & Inks, Style: Printer & Inks
Using my printer almost everyday since Im starting on a sublimation project and I just love it. The printing quality look good The set up was easy and for now Is working 100%
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
N
Verified Purchase
Nadiagne
San Leandro, US
★★★★★ 5
Great 🥰
Style: Printer & Inks, Style: Printer & Inks
The Epson F170 has been ideal for getting started with sublimation. It's easy to use, prints vibrant and defined colors, and has allowed me to personalize various projects with excellent results. As a beginner, it has given me a lot of confidence to learn and create without complications. I definitely recommend it for anyone starting out in sublimation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
J
Verified Purchase
jesus hernandez
Port Orchard, US
★★★★★ 5
100% recommended.
Style: Printer & Inks
It is an affordable and nice printer for those how wants to start a sublimation printer business. It’s works so good. I am using it to heat press cellphone case and it works amazing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
P
Verified Purchase
Pat Traynor
Boise, US
★★★★★ 1
No returns and no support. If it doesn't work properly, too bad.
Style: Printer & Inks, Style: Printer & Inks
I was fairly happy with my Epson ET 2800, but was told that I'd get better colors with the F170. So I bit the bullet. The installation went smoothly and I was printing in short order. It was when I started printing items that had some dark gray that I noticed the problem. It was printing green. I contacted Epson tech support and they answered the phone almost immediately. (And how rare is that??) The woman I spoke with seemed to be familiar with the problem and advised me to modify the printer preferences and change the color correction from "ICM" to "No color correction". Well, it wasn't printing green anymore. Now the grays were brown. At this point, she ran out of ideas and gave me an email address for the second level of tech support and asked if I'd send a photo of the printed fabrics showing the problem. I did. That was over three weeks ago. I've sent a couple of followup emails, but they're ignoring me. But the best news was discovering that there are no returns on this product. I didn't think that was a thing with Amazon and I've never had any problems before. So now the 30-day return window is about to elapse and it appears that I'm stuck with an oversized doorstop. In the photo I'm including with this review, the fabric on the upper-left was printed with my Epson ET 2800. On the upper right, the F170 with ICM color correction. On the bottom, the F170 with no color correction.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 12, 2025
C
Verified Purchase
Cherished1
Los Angeles, US
★★★★★ 5
Epson SureColor F170 Sublimation Printer Rocks!
Style: Printer & Inks, Style: Printer & Inks
TI’m a newbie at sublimation, and this is my first sublimation printer. I love it! I can’t wait to make more things! I like that it’s not too large, but still can print up to 8.5x14”. The quality seems to be really good, but I also don’t have any other printer to compare it to. This was my very first project! I’m very happy with it so far!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026

recommand products