SKU: 79638350647

Human CD326/EPCAM, His tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD326/EPCAM, His tagProduct Specification Species Human Synonyms Adenocarcinoma associated antigen, Cell surface glycoprotein Trop 1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1 4 antigen, KSA, Major gastrointestinal tumor associated protein GA733 2, Tumor associated calcium signal transducer 1, GA733 2, M1S2, M4S1, MIC18, TACSTD1, TROP1 Accession P16422 Amino Acid Sequence Protein sequence (P16422,

Product Specification


Species Human
Synonyms Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1/4 antigen, KSA, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1
Accession P16422
Amino Acid Sequence

Protein sequence (P16422, Gln24-Lys265, with C-10*His) QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 29.1 kDa Observed MW: 32,33 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Epithelial cell adhesion molecule (EpCAM), also known as CD326 among other names, is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell–cell adhesion in epithelia. EpCAM is also involved in cell signaling, migration, proliferation, and differentiation. Additionally, EpCAM has oncogenic potential via its capacity to upregulate c-myc, e-fabp, and cyclins A & E. Since EpCAM is expressed exclusively in epithelia and epithelial-derived neoplasms, EpCAM can be used as diagnostic marker for various cancers. It appears to play a role in tumorigenesis and metastasis of carcinomas, so it can also act as a potential prognostic marker and as a potential target for immunotherapeutic strategies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 79638350647

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jonathan M. Lisee
Bozeman, US
★★★★★ 5
Awesome desktop accessory!
Color: Black
Perfect desktop accessory for maximum functionality. 3 outlets on the back and 2 USB C cables that come out the sides. Holding to the side via a magnet. Charges my devices very quickly. Absolute workhorse for its weight and portability.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
A
Verified Purchase
Arturo R. Agramonte
Omaha, US
★★★★★ 5
Minimalist's Dream
Color: Black, Color: Black
The ultimate desk decluttering tool! I am extremely happy with this 7-in-1 station. The best part is the built-in retractable cables; I no longer have to manage a mess of cords on my desk. It has a very small footprint but packs enough punch to power my laptop and several other devices at once. It’s a high-quality, compact solution that solved all my cable management issues. Five stars!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
A
Verified Purchase
Andrew
Carnegie, US
★★★★★ 5
Good Charging Station!
Color: Black
I’ve been using the Anker Nano 7-in-1 charging station for a few weeks now and overall I’m happy with it. I wanted something that could replace multiple chargers on my desk, and this does exactly that. Being able to plug in a laptop, phone, and a few other devices at the same time without swapping cords has been really convenient. The USB-C ports provide fast charging, including enough power for a laptop, which was important to me. Everything charges reliably and the unit doesn’t get excessively warm during normal use. The build quality feels solid, which is what I’ve come to expect from Anker products. It also doesn’t take up much space, so it works well on a desk or nightstand. One thing to be aware of is that when multiple devices are plugged in, charging speeds can vary depending on what’s connected. It hasn’t been a problem for me, but it’s worth noting. Also, it’s a bit heavier than a basic power strip, so it’s better suited for stationary use rather than travel. Overall, this is a well-made charging station that helps keep things organized and cuts down on cable clutter. If you have several devices to charge and want a cleaner setup, this is a good option. Pros: Charges multiple devices at once Fast USB-C charging, including laptops Solid build quality Helps reduce cable clutter Cons: Charging speed varies with multiple devices Slightly bulky for travel TL;DR: A reliable and convenient charging station that does what it’s supposed to do.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 28, 2026
J
Verified Purchase
Josh McDermott
Fort Morgan, US
★★★★★ 4
Good quality and works perfectly but could use more features.
Color: Black
Overall, it's great, I love the ability to clean up my desk and charge all of my stuff, it really makes it SO much cleaner. However, I feel like it could use more features. The fake screen is 4.5" on 2", however, the actual embedded screen is under 1"/1". Also, the USB-C numbering system seems to be off, but I recognize this is all super picky. I really wish they had used the face area to put a clock or a larger screen. The charge speed is great, but I haven't tried charging my laptop or anything heavy off of it. Overall, if you don't care about the minor gripes ,then it's perfect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025
T
Verified Purchase
TBarron
Dallas, US
★★★★★ 5
Perfect charging port for the minimalist look
Color: White
This charging station is amazing. I needed something minimal to go on my desk and I was so tired of having cords everywhere. The fact that there are two retractable usb c ports is an absolute game changer. Love the look overall and charging capabilities are endless. Love that there are extra outlets as well as an addition usb c and a port. Great value for the money and definitely look out for deals. This thing is perfect. May have to buy another one for the bedroom nightstand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026

recommand products