SKU: 81148194594

Human Haptoglobin, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Haptoglobin, His tagProduct Specification Species Human Accession P00738 Amino Acid Sequence Protein sequence(P00738, Val19 Gln160&Ile162 Asn406, with C 10*His)

Product Specification


Species Human
Accession P00738
Amino Acid Sequence

Protein sequence(P00738, Val19-Gln160&Ile162-Asn406, with C-10*His)
VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAENGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 44.8kDa Actual: 57-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Haptoglobin (abbreviated as Hp) is the protein that in humans is encoded by the HP gene. In blood plasma, haptoglobin binds with high affinity to free hemoglobin released from erythrocytes, and thereby inhibits its deleterious oxidative activity. Compared to Hp, hemopexin binds to free heme. The haptoglobin-hemoglobin complex will then be removed by the reticuloendothelial system (mostly the spleen).Haptoglobin is an acute-phase protein, its concentration in plasma changes in pathology, and the test for its concentration is part of normal clinical practice. Haptoglobin is a conservative protein synthesized mainly in the liver and lungs and is the subject of research as a potential biomarker of many diseases, including various forms of malignant neoplasms.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81148194594

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Stan Ohis
Port Orchard, US
★★★★★ 4
I Smell Like a Gentleman Who Owns a Fireplace
Scent: Bourbon Oak, Size: 16 Fl Oz (Pack of 1)
The fragrance is warm, woody, and slightly sweet...that low amber note that smells expensive without trying to smell expensive, which, as we all know, is the actual expensive smell. My wife walked past me twenty minutes post-shower and said, unprompted, "You smell really good." I nodded like I had planned this. The lather is genuinely rich; squeeze a modest amount and it blooms into a thick, creamy foam that covers everything efficiently. The texture is silky rather than watery, which matters more than people admit. Watery body washes feel like rinsing off with slightly scented regret. This one feels intentional. It cleans, and your skin actually feels clean afterward, not just rinsed. And the moisturizing? I wasn't expecting it. No greasy film, no lotion-begging dry patches by midday. Just quietly softer skin that doesn't make a big announcement about it. Now, my honest gripe: the scent longevity has a ceiling. By mid-afternoon you're back to neutral. That's the gap between four stars and five for me. For daily freshness and an incredible morning window of smelling genuinely great, it absolutely delivers...but it won't carry you to bedtime. On value: 16 fl oz is decent, the lather is efficient so the bottle lasts, and the price sits in that sweet spot where you feel like someone who makes slightly elevated but still reasonable choices, which is exactly the vibe this entire product is going for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
K
Verified Purchase
Kindle Customer
Cuba, US
★★★★★ 5
Lathers great in a small amount!
Scent: Bergamot, Size: 16 Fl Oz (Pack of 1), Scent: Bergamot, Size: 16 Fl Oz (Pack of 1)
Lathers great for a small amount! A fair price for the amount and rich content. I just bought, used and love it. Definitely will purchase again. I love the sophisticated yet sensible smell doesn't overpower. In my perception it is a unisex scent as I am a woman and bought for myself.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
M
Verified Purchase
Minh Ngo
San Leandro, US
★★★★★ 5
My favorite body wash
Scent: Bergamot, Size: 16 Fl Oz (Pack of 1), Scent: Bergamot, Size: 16 Fl Oz (Pack of 1)
My go to body wash, you just get so much for the price and it lasts forever! The smell itself is also very relaxing after a long day. It also lathers quite nicely and does it's job well, would definitely recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
J
Verified Purchase
JP De Oliveira Estêvão
Alexandria, US
★★★★★ 5
Smells Like You Have Your Life Together
Scent: Bergamot, Size: 16 Fl Oz (Pack of 1)
Cremo Body Wash with Italian Bergamot, Neroli Blossom, and Fresh Vetiver smells far more expensive than it has any right to. The scent hits that sweet spot between fresh and refined. The bergamot gives it a clean citrus lift, the neroli adds a smooth floral edge, and the vetiver grounds it with a subtle, masculine depth that does not scream but absolutely speaks. The lather is rich and concentrated, so you only need a small amount. It feels more like something you would find in a boutique hotel than on a regular store shelf. The fragrance lingers just enough to be noticed without overpowering your cologne or filling the entire room. If you want to step out of the shower smelling like competence and quiet confidence, this one delivers. It is polished without trying too hard, and it makes everyday showers feel slightly upgraded.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2026
S
Verified Purchase
Sully Cortez
Port Orchard, US
★★★★★ 5
The best hand soap bars PERIOD.
Size: 3.5 Ounce (Pack of 3), Size: 3.5 Ounce (Pack of 3)
Wow! I am actually VERYYYY impressed with this soap. Believe me when I tell you I have tried everything from $5 for 6 bars soap to $50 for 1 bar soap (not an exaggeration). And I can wholeheartedly say this is the absolute best bang for your buck when it comes hand washing/soap. To me these little bars are absolutely awesome for hand washing. I use the scrubby bar when I have a ton of grease after eating say pizza or something & and then I use the moisturizing bars for all other hand washing. These bars blow away some of the best artisan expensive bars I’ve used like Caldwell Massey or Gentleman’s Nod or Ariana & Evans. These are now go to hand soap bars and I will use nothing else because these are so good. I don’t use liquid soap because I feel like I can never get it off and it feels like it’s always still stuck to my skin even after rinsing and rinsing and rinsing so I like using bar soap and I like bar soap that really dry out your skin for your hands and these little bars do it extremely well without over drying your skin. I do wish the scent was a bit more powerful because all 3 bars have a nice scent each. Tried the sandalwood bar in the shower and like I suspected go with the 6oz bars for the shower because these little 3.5oz guys just go too quickly for all over body use. So for the shower, I’ll use the 5.3/6oz bars and my hands these little guys will now be my go to!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026

recommand products