SKU: 81148194594

Human Haptoglobin, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Haptoglobin, His tagProduct Specification Species Human Accession P00738 Amino Acid Sequence Protein sequence(P00738, Val19 Gln160&Ile162 Asn406, with C 10*His)

Product Specification


Species Human
Accession P00738
Amino Acid Sequence

Protein sequence(P00738, Val19-Gln160&Ile162-Asn406, with C-10*His)
VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAENGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 44.8kDa Actual: 57-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Haptoglobin (abbreviated as Hp) is the protein that in humans is encoded by the HP gene. In blood plasma, haptoglobin binds with high affinity to free hemoglobin released from erythrocytes, and thereby inhibits its deleterious oxidative activity. Compared to Hp, hemopexin binds to free heme. The haptoglobin-hemoglobin complex will then be removed by the reticuloendothelial system (mostly the spleen).Haptoglobin is an acute-phase protein, its concentration in plasma changes in pathology, and the test for its concentration is part of normal clinical practice. Haptoglobin is a conservative protein synthesized mainly in the liver and lungs and is the subject of research as a potential biomarker of many diseases, including various forms of malignant neoplasms.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81148194594

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jess M
Houston, US
★★★★★ 5
Must have item for dogs!!!
Size: Medium (Pack of 1), Color: Pink
The puppy kong is a must have item for every new puppy owner. Super cute!! They usually will last forever (unless you have a super chewer then you need the black one). Great value!! Keeps the puppy busy and entertained. Especially when frozen. Google and the Kong website have tons of recipes. I tend to stick with a little bit of kibble some mashed banana and peanut butter. Also, good options are jars or pouches of baby food just make sure you check the label to ensure there is nothing toxic to dogs in it. More options are kibble soaked in water or broth, pumpkin puree, green beans and carrots. I could go on forever. If you own a dog, a Kong is a must have! I always have two ready to go. And they are dishwasher safe!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026
B
Verified Purchase
Bill
Fort Morgan, US
★★★★★ 5
Keeps her occupied!
Size: Extra Small (Pack of 1), Color: Pink
It works very well when sruffed with a healthy, soft treat. It keeps our little teething scamp busy for a while and stops her from chewing on household items including her humans!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
M
Verified Purchase
M Velez
Alexandria, US
★★★★★ 5
Teeny Tiny Terrific Toy
Size: Extra Small (Pack of 1), Color: Pink
Perfect for a mini puppy! So teeny tiny; it cracks me up looking at it!! However, my little dog (10 week old Cavapoo) absolutely loves playing with it! It’s her fav! You can stuff 2-5 tiny treats in it to keep puppy occupied and focused.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
N
Verified Purchase
Nori Ochi
Los Angeles, US
★★★★★ 5
Must have for a young puppy
Size: Small (Pack of 1), Color: Blue
Very helpful for our young puppy. Cleaning it isn't the easiest, but cleaning advice is easily found online and it's worth the hassle to have a durable lasting toy around
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
N
Verified Purchase
Nina
Lexington, US
★★★★★ 5
My yorkie loves this!!
Size: Extra Small (Pack of 1), Color: Blue
My Yorkie loves this KONG puppy toy! It keeps him entertained and is perfect for his size. It feels durable and well made, and I’m really happy with this purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026

recommand products