Human Haptoglobin, His tag
SKU: 81148194594

Human Haptoglobin, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Haptoglobin, His tagProduct Specification Species Human Accession P00738 Amino Acid Sequence Protein sequence(P00738, Val19 Gln160&Ile162 Asn406, with C 10*His)

Product Specification


Species Human
Accession P00738
Amino Acid Sequence

Protein sequence(P00738, Val19-Gln160&Ile162-Asn406, with C-10*His)
VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAENGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 44.8kDa Actual: 57-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Haptoglobin (abbreviated as Hp) is the protein that in humans is encoded by the HP gene. In blood plasma, haptoglobin binds with high affinity to free hemoglobin released from erythrocytes, and thereby inhibits its deleterious oxidative activity. Compared to Hp, hemopexin binds to free heme. The haptoglobin-hemoglobin complex will then be removed by the reticuloendothelial system (mostly the spleen).Haptoglobin is an acute-phase protein, its concentration in plasma changes in pathology, and the test for its concentration is part of normal clinical practice. Haptoglobin is a conservative protein synthesized mainly in the liver and lungs and is the subject of research as a potential biomarker of many diseases, including various forms of malignant neoplasms.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81148194594

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 446 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Liliana C Viloria V
Alexandria, US
★★★★★ 5
Genial
Size: One Size, Color: (015) Tetra Gray / Gray Matter / White Quartz
Me encanta la textura y sobre todo que tiene para que siempre sepas en cuál pies va!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 29, 2025
M
Verified Purchase
m
Alexandria, US
★★★★★ 5
Comfortable
Size: One Size, Color: (348) Silica Green / White / Titan Gray
Comfortable and stays in place
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2025
S
Verified Purchase
Sukoshi
Whiting, US
★★★★★ 5
Best socks for work or working out.
Size: One Size, Color: (015) Tetra Gray / Gray Matter / White Quartz
Great socks. They stay on your heel! Love the material; breathable and not thick. Love the neutral tone colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2025
C
Verified Purchase
Cassandra Moxlow
Whiting, US
★★★★★ 3
Didn’t meet full expectations
Size: One Size, Color: (001) Black / Black / Jet Gray
Much shorter than anticipated.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025
S
shannon oakley
Natrona Heights, US
★★★★★ 5
Great room divider
Color: Black, Size: 4 Panel-88'', Color: Black, Size: 4 Panel-88''
This is a room divider and would work great as one! I’m using it as a cover for my car port/garage so you can’t look in and see my messy garage as easily and for what I’m using it for it’s a little not quite as sturdy as I need it to but I’m sure it’s not meant to be used outside anyways so I don’t fault the product since I’m not using it as intended… with that said though…. It still covers my garage beautifully and really does exactly what a I need it to! I’m sure the wind may blow it over if it gets too crazy but I don’t see it breaking by any means. The frame is metal and drilled together using long screws. It’s very well built. The cloth for the panels is this waterproof type material that’s kind of like the gazebo roof feeling. So it’s easy to clean and it’s easy to wipe. You can put it straight or bend the panels and either way it still stands up. You don’t HAVE to bend it to make it stand or anything. You can literally use it straight across like I am in the pictures. Overall very happy with this product and it’s also very tall so it truly covers a lot (hides a lot lol). I’m 5’8 so you can see it’s taller than me by the pic I took
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026

recommand products