SKU: 81223218388

Human MMP3, His tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MMP3, His tagProduct Specification Species Human Synonyms Stromelysin 1, Matrix metalloproteinase 3 (MMP 3), Transin 1, SL 1, STMY1 Accession P08254 Amino Acid Sequence Protein sequence (P08254, Tyr18 Cys477, with C 10*His)

Product Specification


Species Human
Synonyms Stromelysin-1, Matrix metalloproteinase-3 (MMP-3), Transin-1, SL-1, STMY1
Accession P08254
Amino Acid Sequence

Protein sequence (P08254, Tyr18-Cys477, with C-10*His) YPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Predicted MW: 53.9 kDa Observed MW: 60 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Stromelysin-1 is an enzyme that in humans is encoded by the MMP3 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix proteins and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The MMP-3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, MMP-3 can also activate other MMPs such as MMP-1, MMP-7, and MMP-9, rendering MMP-3 crucial in connective tissue remodeling. The enzyme is also thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. MMP3 can enter in cellular nuclei and control transcription. MMP-3 has been implicated in exacerbating the effects of traumatic brain injury (TBI) through its disruption of the blood-brain barrier (BBB). MMP-3 also does damage to the blood-spinal cord barrier (BSCB), the functional equivalent of the blood-brain barrier, after spinal cord injury (SCI).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81223218388

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Birmingham, US
★★★★★ 1
This product is not worth the price.
The screws were still very loose even after being tightened, and they couldn't be made to fit tightly. This resulted in the entire product being loose and unsteady. I spent 31 US dollars on this defective item. I'm very regretful. I will return it. The overall workmanship is not perfect. It's too bad!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
V
Vine User
Grantham, US
★★★★★ 5
Smooth Rotating Organizer – Looks Great & Holds a Lot
This was a hit in our house. I originally got it for myself, but my wife quickly pointed out that she has about 20 perfumes while I only have a few colognes… so it officially became hers. The assembly was very easy, with clear instructions that made putting it together quick and straightforward. Once assembled, it has a really nice black wood grain finish that looks clean and modern on a dresser or bathroom counter. The 360° swivel works smoothly, which makes it easy to access everything without having to move bottles around. It also holds a good amount, so it’s perfect for anyone with a growing collection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
V
Verified Purchase
Virginia Wharton
Massapequa, US
★★★★★ 5
It is really well made and perfect for travel!
It is just like the picture and it is lovely. Plenty of room and under the tray it is large enough for changes with pendents. It is perfect for a girl and will be perfect for the amount of jewerly you take when traveling. Thank You!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025
J
Verified Purchase
Jamie C.
Boise, US
★★★★★ 5
Very nice little box.
This is a great little jewelry box. I don’t have tons of jewelry right now, so this fits everything well, and the leather-look material is very nice. I like the simple design and organization, and it is a nice size to travel with. It looks really pretty sitting on my dresser and goes with the aesthetic of my home well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2025
S
Verified Purchase
Suly
Whiting, US
★★★★★ 4
Pretty
Very nice simple jewelry box. My only issue is spacing to put necklaces is a bit tight, but there is plenty of room in this little guy. I put a lighter next to it, for size comparison.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026

recommand products