SKU: 81495002018

MERTK His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MERTK His Tag Protein, MouseProduct Specification Species Mouse Synonyms MER, STK Kinase, Tyro12, C Eyk, C Mer, RP38 Accession Q60805 Amino Acid Sequence Gly19 Met497, with C terminal 8*His

Product Specification


Species Mouse
Synonyms MER, STK Kinase, Tyro12, C-Eyk, C-Mer, RP38
Accession Q60805
Amino Acid Sequence

Gly19-Met497, with C-terminal 8*His GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 80-110kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Graham, D.K. et al. (1994) Cell Growth Differ. 5:647.

2.Graham, D.K. et al. (2006) Clin. Cancer Res. 12:2662.

Background

Tyrosine-protein Kinase Mer, also known as c-Mer and MerTK, is a member of the receptor tyrosine kinase subfamily TAM (Tyro3, Axl, and Mer). Similar to Axl and Tyro3, the extracelluar domain of Mer contains two Ig-like motifs and two fibronectin type III motifs. Mer is not expressed in normal B- and T-cells but expressed in neoplastic B- and T-cell lines . It is also show higher expression in immunosuppressive M2‑like macrophages. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.Mer is known to bind Gas6, Protein S, Tubby, Tubby-like protein 1 (Tulp1), and Galectin-3. Upon binding ligands via the Ig-like motif, Mer is dimerized to trans-autophosphorylate the kinase domain to induce downstream signaling. It has been shown that Mer signaling in macrophages induces M2 polarization, which promote tumor growth, metastasis and evasion of anti-tumor immunity in tumor microenviroment. Inhibition of Mer, especially on leukocytes and macrophages, is an effective anti-cancer therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81495002018

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
TheGreatWifeShark
Lowell, US
★★★★★ 5
Great Quality!
Color: Ivory White, Size: 2' x 6' (Sheepskin Shape), Color: Ivory White, Size: 2' x 6' (Sheepskin Shape)
I have owned many sheepskins before and this one is by far the best deal. Cheaper than similar sizes, but not in a bad way! It’s a beautiful creamy white, super plush, and is very long. We keep it on the back of our couch and it gives a very cozy vibe. I haven’t had any issues with it shedding. Word of advice for cat owners: When we first got it, it did have a sheepskin smell but it isn’t a gross smell and it went away within a few days; however, my cat was very attracted to that smell and was “attacking” the sheepskin. We trained her not to do it just by spraying her with water—after a few times of that she stopped going anywhere near it. Now that the smell has dissipated, she isn’t attracted to it anymore but does like to sit on it every once and awhile (I can’t blame her, it’s sooooo soft). I saw someone else say their cat ruined their rug, so I wanted to give our story on how we prevented that and hopes it helps another cat owner. You just have to be alert for the first day, maybe even let it off-gas outside first, then keep a spray bottle nearby and the cat should stop messing with it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2025
K
Verified Purchase
KFF
Lake Worth, US
★★★★★ 5
Great little rug!
Color: Ivory White, Size: 2' x 3' (Sheepskin Shape), Color: Ivory White, Size: 2' x 3' (Sheepskin Shape)
This nice little sheepskin rug is the perfect finishing touch to my little reading nook. It’s soft and thick. Follow the enclosed instructions to fluff it up. I was going to order a second one but saw that the price jumped nearly $10 in a week. It’s nice but it’s not worth that amount. I’d buy it on sale though. Five stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
E
Verified Purchase
EMS
Fort Morgan, US
★★★★★ 5
Definitely genuine pelts.
Size: 2' x 3' (Natural shape, Sheepksin, Oblong), Color: Ivory White
I like the color. Not too white, more of a natural shade. I ordered two, for each side of the bed. One is larger than the other which proves they are genuine pelts and I’m ok with it!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
C
Verified Purchase
Cindy Cruse
San Leandro, US
★★★★★ 5
Great small size rug
Size: 2' x 3' (Natural shape, Sheepksin, Oblong), Color: Ivory White
Size is great, I wanted to use as a throw on a leather ottoman and it fit great. It isn’t exactly the color I expected but it is a neutral cream. Soft and comfortable. Well made.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2026
J
Verified Purchase
Jess
Natrona Heights, US
★★★★★ 4
Nice
Size: 2' x 3' (Natural shape, Sheepksin, Oblong), Color: Ivory White
Nice product! Slightly different texture than anticipated
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025

recommand products