SKU: 81723276181

Human Myoglobin, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Myoglobin, His TagProduct Specification Species Human Synonyms symbol Mb, MB Accession P02144 Amino Acid Sequence Protein sequence (P02144, Met1 Gly154 with C 10*His) MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 18. 8kDa Actual: 20kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms symbol Mb, MB
Accession P02144
Amino Acid Sequence

Protein sequence (P02144, Met1-Gly154 with C-10*His)


MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 18.8kDa Actual: 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Liquid
Stability & Storage

12 months from date of receipt, -20℃ as supplied.

Background

Myoglobin (symbol Mb or MB) is an iron- and oxygen-binding protein found in the cardiac and skeletal muscle tissue of vertebrates in general and in almost all mammals. Myoglobin is distantly related to hemoglobin. Compared to hemoglobin, myoglobin has a higher affinity for oxygen and does not have cooperative binding with oxygen like hemoglobin does. In humans, myoglobin is only found in the bloodstream after muscle injury. Myoglobin is a sensitive marker for muscle injury, making it a potential marker for heart attack in patients with chest pain. However, elevated myoglobin has low specificity for acute myocardial infarction (AMI) and thus CK-MB, cardiac troponin, ECG, and clinical signs should be taken into account to make the diagnosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81723276181

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Ms.Merryweather
Cuba, US
★★★★★ 5
Excellent 100% as advertised
Format: Paperback
Excellent condition and cost $100 LESS than the college bookstore! Will definitely be on Amazon first thing next semester
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2022
H
Howard K. Brodsky
San Leandro, US
★★★★★ 4
Taking another look at this book
Format: Paperback
I am revising my review in fairness to the author. I purchased this book on the secondary market. For my initial review I had not read the book cover to cover. This book features an anthology of philosophical excerpts and writings on different topics concerning contemporary issues in ethics. The author prefaces each topic section with an overview of the pertinent legal, historical and social developments. This is followed by contributions on the subject from different philosophical viewpoints. Some of these contributions can be rather turgid, others easily digestible. As a whole, I find the book to offer good coverage of the topics. The book addresses many ethical issues with a fair degree of contemporaneous coverage but more ethical questions of seminal import are required. For instance, perhaps there ought to be other topics introduced for future revisions that are more poignant to life in the national security state, such as the ethics of social vigilance in response to domestic government spying, the abrogation of habeas corpus and war crimes such as droning and torture. These are serious ethical conundrums in our society that deserve consideration in any philosophy course focusing on contemporary issues in ethics. Having a more comprehensive reading of this book I have significantly upgraded my appreciation of its coverage and the work that went into it and I would recommend it to professors looking to introduce ethics studies in a philosophy curriculum.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 28, 2014
P
Verified Purchase
Papi B
Natrona Heights, US
★★★★★ 5
Very insightful, and there are a ton of readings ...
Format: Paperback
Very insightful, and there are a ton of readings that make this book more and more interesting with every coming chapter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 30, 2017
Y
Verified Purchase
yvonne
Louisville, US
★★★★★ 5
... value professor is making us put this book to great use.
Format: Paperback
My human conduct & value professor is making us put this book to great use.. Awesome!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2015
T
Verified Purchase
Tree
New York, US
★★★★★ 1
Unethical book
Format: Paperback
Had to get this book for a required class. This book is unreadable. It is written in an outdated language of old philosophers. The book itself if unethical. It starts out with one inch margins then once you get into it they switch to half inch margins. That's deceitful. Everyone I have talked to in the class can't stand the book. l read it because I have to, but I'm not getting anything out of it. Humanity is certainly lacking ethics these days, but this book is a waste of my time and if I'm struggling reading it, I doubt anyone who actually needs to read this book will make it through more than a page.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 30, 2016

recommand products