SKU: 82424726976

GITR/TNFRSF18 Fc Chimera Protein, Human

Sale price$250.65 Regular price$278.50
Save 10%

Pay in installments of $69.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GITR/TNFRSF18 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CD357 antigen, CD357, GITR, GITR D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid induced TNFR related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18 Accession Q9Y5U5 1 Amino Acid Sequence Gln26 Glu161, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms CD357 antigen, CD357, GITR, GITR-D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid-induced TNFR-related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18
Accession Q9Y5U5-1
Amino Acid Sequence

Gln26-Glu161, with C-terminal Human IgG Fc QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 40-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1,Nature Communications volume 12, Article number: 1378 (2021) Cite this article  5809 Accesses  9 Citations  1 Altmetric  Metrics.

Background

GITR(Glucocorticoid-induced Tumor necrosis factor Receptor), also known as AITR and TNFRSF18, is a 40 kDa transmembrane glycoprotein belonging to the tumor necrosis factor receptor (TNF-R) superfamily. Mature human GITR consists of a 137 amino acid (aa) extracellular domain (ECD) with three tandem TNFR cysteine-rich repeats, a 21 aa transmembrane segment, and a 58 aa cytoplasmic domain. GITR is expressed on CD4+CD25+ regulatory T cells (Treg) as well as on subsets of thymocytes, lymph node cells, and splenocytes. GITR plays a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 82424726976

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lynn
New York, US
★★★★★ 5
Son's behavior changed immediately!
Format: Paperback
Our 4-yr-old son was not following directions at school. His teacher had come back from maternity leave and he had gotten into some bad habits while she was gone. After reading this book he memorized all the steps and repeats them multiple times a day. It's only been one week but he has been a different child entirely -- an angel! We had been talking to him for 9 months about "making good choices" but had never qualified that a good choice was one that makes the situation better (and a bad choice one that makes the situation worse). Apparently that was key! I'm not surprised that this was written by an educator who probably saw a lot of success by clarifying this distinction with his students. I'm sure my son's amazing behavior won't last forever, but it's great to simply know that he has it in him to control his impulses. We are going to make little print-outs of the 4 steps to let him have them at school and share these tips with his teacher so she can prompt him with the same language. Great, great book!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2019
L
Verified Purchase
lisa b.
Draper, US
★★★★★ 4
Helpful for learning impulse control
Format: Paperback, Format: Paperback
This book helped to remind my grandson to use the four steps to work on becoming an "impulse expert".
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
N
Verified Purchase
Nana
Houston, US
★★★★★ 5
Every kid needs to know what’s in this book!
Format: Paperback
I ordered this for my grandson, it’s a fabulous book! It really made him think and he wanted me to laminate the teachers rules!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
S
Verified Purchase
Sarah V
Bozeman, US
★★★★★ 5
Excellent! Interests son w/ relatable situations, upbeat tone, & teaches to think before acting.
Format: Paperback
Kid & parent approved! Excellent book that really engages my five-year-old son. It has relatable scenarios that gets kids thinking & teaches them to think things through before acting (impulse control) to make better choices, without talking down to them, in a fun upbeat tone. My son has asked to read the book over and over. I think he likes the realistic writing style & illustrations too. The author, a former school counselor, clearly gets kids. It is a great tool for our family. I have since bought multiple books from this author. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2019
A
Verified Purchase
Anne La Chapelle
Pawtucket, US
★★★★★ 5
Age
Format: Paperback
Great book for elementary school aged kids
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2025

recommand products