SKU: 84888927934

Human GSPT1 ,GST tag Protein

Sale price$196.20 Regular price$218.00
Save 10%

Pay in installments of $54.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GSPT1 ,GST tag ProteinProduct Specification Species Human Synonyms ERF3A Accession P15170 3 Amino Acid Sequence D437 V633 DGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV Expression System E. coli Molecular Weight 48. 9 kDa Purity >90% by SDS PAGE Conjugation Unconjugated Tag GST Tag Physical Appearance Liquid Storage Buffer

Product Specification


Species Human
Synonyms ERF3A
Accession P15170-3
Amino Acid Sequence

D437-V633

DGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV

Expression System E.coli
Molecular Weight

48.9 kDa

Purity

>90% by SDS-PAGE

Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 84888927934

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Josie erdy
Alexandria, US
★★★★★ 4
Heartwarming queer love story
Format: Paperback
I LOVED this book. It’s the most refreshing, queer, lesbian, second chance, finding your way back home story. From almost throwing hands to falling back in love, it was a wonderful journey of reflection in both women and their growth as a couple. It reminds me so much of Columbus ohios gay community and just such a supportive and loving city. My ONE complaint would be that I felt the ending was rushed. It was just like “oh hey I still love you, cancel the sale, done”. I would’ve loved a little more of an ending or even an epilogue. I kinda felt… incomplete at the end which made me sad!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2025
M
Mary-Catherine
Draper, US
★★★★★ 3
Bed and Breakup
Format: Kindle
Bed and Breakup is a dual POV forced-proximity second chance romance. Estranged wives Molly and Robin both return to the Bed and Breakfast they co-own after seven years apart, each needing to recharge creatively and figure out their next steps. Despite not wanting to cohabitate, they reluctantly agree to work together to refurbish the inn so they can sell it and finally break ties with each other for good. Working in close proximity stirs up memories, the good with the bad, leaving both confused about what next steps to take. This was an enjoyable and well written ARC and I will definitely look for more from this author. This book, though, just wasn’t the right fit for me. I really LOVE second-chance romance, but this book was missing two aspects that draw me to them: I didn’t feel like the reason for the initial breakup was all that forgivable and fully resolved, and usually in second-chance romance you have at least one character working towards the end goal of reconciliation established pretty early on. However, I did love the small town, the many side characters, and the passions Molly and Robin had (artistic and culinary). I would definitely recommend this book even though it wasn’t a perfect fit for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 1, 2025
M
Mx. Phoebe's Viewpoint
Belleville, US
★★★★★ 4
a second-chance romance with humor, steaminess, friendship, and love.
Format: Kindle
Going back to where you felt safe and loved to close that chapter and then finding your ex there is beyond complicated. Both Robin and Molly go back to Eureka Springs for reasons other than personal as they both happen to be there for professional reasons too. This makes leaving almost impossible. An opportunity to close their chapter, with some cash too, sends them spiraling towards confrontations, pranks, and some hanky panky. I enjoyed Bed and Breakup. After reading Susie Dumond’s afterword, it was nice knowing that a place like Eureka Springs actually exists. Where people can exist in harmony and be celebrated for who they are - everyone. The banter is fun even when there is a trace of anger and pain. I think because you know this is a romance and nowadays, they usually come with a happy ending, you know this too shall pass. Dumond does make you rethink a prank though. Holy sugar. I will confess that the first one would give me the heebie-jeebies too. The chemistry is good, and the details are in even better 😆. I think it does kind of suck that they were both with other partners while still being married, but I guess that’s real life. It’s just weird to be thinking in the middle of things, “oh that’s new, she must have learned that while boinking someone else.” It kind of brings an ick factor into it. There is something missing for me on Robin’s side. We get to see Molly’s reaction all of the time to Robin’s cooking and artistry in the kitchen. Robin sees Molly’s work once. We never see her walking down the street after the installation of the three storefronts that Molly did and have her admire them or be in awe. Molly researched Robin’s restaurants and talked to her artist to artist. Robin didn’t even bother. She just wanted her to work on the inn even when things were going well for them. It felt like she never really respected Molly’s artistry. Where was the caring when Molly sliced up her hands trying to get the jimmies just right on the donuts in the window? I don’t know, it just seemed very one sided. I love the diverse secondary cast. I love Key and how she is represented in this book. She checks everyone all of the time and reminds them that she is a proud Black woman. She’s striving to make the town stronger and for businesses to grow for her community. I love this. I hope Dumond goes back to Eureka and writes Key’s love story. She’s feisty, loyal, artistic, and strong. I adore her. Heck, I’d date her. Bed and Breakup is a second-chance romance with humor, steaminess, friendship, and love. I loved escaping to Eureka Springs. Add this one to your beach bag for a good time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 28, 2025
B
Verified Purchase
Book Reviews
Belleville, US
★★★★★ 5
Poignant Account
Format: Kindle
Fascinating account of a young woman's journey through two years of bleakness and danger in Canada's tar sands. I was drawn to this graphic novel because of its unusual subject matter and was impressed with its depth and insights -- just who is that is drawn to these places and this kind of life and why? It was even darker than expected as well as one more argument to end fossil fuels -- not only for their contribution to climate change, but because of the extreme damage they do to the environment and to the people who work in this industry and those who live nearby. A beautifully honest work of art.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 24, 2025
L
Verified Purchase
Lyuba Dutchak
Waukegan, US
★★★★★ 5
A both pragmatic and intimate window into the effects of economic displacement on the working class
Format: Kindle
Beaton's autobiographical account puts the reader into the position of a working class young person making the most practical economic decision for herself - and therefore exposing herself to the surreal realities that post-NAFTA capitalism and environmental crisis life have created for not only working class families in Canada, but to the lands and lifestyle they once loved and cherished. In these pages that plainly display slice of life interactions without exaggeration or fanfare, the experience is natural and never preachy. Behind the grounded focus on day to day life, the economic system of worship of money over human-to-human relationships and human-to-nature relationships is the understated undercurrent. From that current rises the dust covered, inherently temporary, inherently not-treated-as-a-home, world of the oil sands and work camps and the psychology that they create, which Beaton unflinchingly examines. I, too, chose to avoid the pit of student loans, but rather in the United States and by joining the US Army as a female soldier. These accounts would be very poignant to any female veteran, especially anyone who has been on a combat deployment. I highly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 20, 2024

recommand products