SKU: 85753129676

Nucleocapsid CTD His Tag, SARS-CoV-2

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Nucleocapsid CTD His Tag, SARS-CoV-2Product Specification Species SARS CoV 2 Synonyms SARS CoV 2 coronavirus NP Protein; SARS CoV 2 np Protein; SARS CoV 2 novel coronavirus Nucleoprotein Protein Accession P0DTC9 Amino Acid Sequence MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP. Expression System E. coli Molecular Weight 14. 5 kDa () Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g

Product Specification


Species SARS-CoV-2
Synonyms SARS-CoV-2 coronavirus NP Protein; SARS-CoV-2 np Protein; SARS-CoV-2 novel coronavirus Nucleoprotein Protein
Accession P0DTC9
Amino Acid Sequence MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP.
Expression System E.coli
Molecular Weight 14.5 kDa (还原状态)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM PB, 100mM NaCl, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Nucleocapsid, nucleocapsid protein, is an important structural protein of novel coronavirus SARS-CoV-2, which is responsible for wrapping the virus RNA genome and then assembling virus particles. Nucleocapsid has two domains: NTD and CTD, in which CTD has two functions: binding to RNA genome and forming homodimer. There are many positively charged amino acid residues on the surface of CTD protein, which can bind to the negatively charged RNA genome by charge interaction. The two molecules of CTD can form a homodimer through the hydrophobic interaction between β-strands, and then form a higher-order polymer complex. Therefore, CTD plays an important role in the process of virus replication and assembly. In the process of novel coronavirus SARS-CoV-2 therapeutic drug development, CTD inhibitors have become a hot target for drug screening. At the same time, the antigen detection kit developed for CTD provides a more efficient and accurate detection method for SARS-CoV-2 detection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 85753129676

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mark
Chelsea, US
★★★★★ 5
Yes, Being A Man I was Forced To Buy A New Wallet After 18 Years!
Yes, I had a wallet for 18 years, I even rebuilt it with tape when parts of it were falling apart. Even if the tape didn't match the color of the wallet I'm obviously so creative that I added to that old wallet with color! I know many of you are applauding me for sharing this idea so I thank you! Anyway, this is a nice solid well priced wallet & looks like my old one minus the tape. I highly recommend it. If only I had time, I'd share more ideas like how I fixed my leaky roof.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 30, 2024
G
Verified Purchase
Glenn
Lexington, US
★★★★★ 5
Double stitched on edges
Size: One Size, Color: Black
It’s good quality and folds down small. I did cut out the inside flap with a clear plastic window so the wallet would fold flatter. It’s the only wallet I could find with double stitching. Seems good so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 7, 2023
P
Verified Purchase
Plkdavis
New York, US
★★★★★ 5
Amazon Essentials Men's Bifold Wallet
I bought the Amazon Essentials Men's Bifold Wallet for my husband. He was delighted with the wallet to replace his old worn out one. It is thin but very well made.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2023
A
Verified Purchase
Alex McNabb
Phoenix, US
★★★★★ 3
Very Tight Fit
Size: One Size, Color: Black
I did get this wallet as a replacement for a decade-old wallet that was falling apart. I don't have many credit cards that I ever use, but you won't be able to put in more than 1 per slot. I also don't know what the slot on the other side of the ID holder is for. It doesn't fit a credit card at all. I'm hoping that over time it will loosen up. PROS: - Great wallet for people with less than 6 cards/IDs to put in, including rewards cards - Good value for the cost CONS: - Really tight in every card slot and ID slot
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2023
M
Verified Purchase
Miss B
Fort Morgan, US
★★★★★ 5
Slim wallet is soft and serviceable.
I decided to buy a men's billfold because I no longer wanted the typical bulky thick wallet from the women's department. This billfold has plenty of room for cash, many credit cards and driver's license. Takes up much less room in my purses. It's soft and rich looking despite its reasonable price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 2, 2020

recommand products