SKU: 86338277998

Rat Ig gamma-1 chain C region, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat Ig gamma-1 chain C region, His tagProduct Specification Species Rat Accession P20759 Amino Acid Sequence Protein sequence (P20759, Ala1 Lys326, with C 10*His)

Product Specification


Species Rat
Accession P20759
Amino Acid Sequence

Protein sequence (P20759, Ala1-Lys326, with C-10*His) AETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNCGGDCKPCICTGSEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISQDDPEVHFSWFVDDVEVHTAQTRPPEEQFNSTFRSVSELPILHQDWLNGRTFRCKVTSAAFPSPIEKTISKPEGRTQVPHVYTMSPTKEEMTQNEVSITCMVKGFYPPDIYVEWQMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKEKWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 37.6 kDa Observed MW: 45-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Ig gamma-1 chain C region (IGHG1) is considered an emerging prognostic marker. The upregulation of IGHG1 is strongly associated with various malignancies, including colorectal cancer, gastric cancer, prostate cancer, papillary thyroid carcinoma, leukemia, ovarian cancer, and breast cancer. In colorectal cancer, the upregulation of IGHG1 contributes to increased cellular proliferation. MEK-FECH signaling is upregulated in IGHG1-overexpressing colorectal carcinomas. IGHG1 overexpression has also been reported for the induction of epithelial to mesenchymal cell transmission (EMT) in gastric cancer via tumor growth factor beta (TGF-β)/SMAD3 signaling. In prostate cancer, the inhibition of IGHG1 is linked to the suppression of MEK/ERK/c-Myc signaling, leading to reduced malignant growth. The increased expression of IGHG1 in breast cancer cells activates AKT and vascular endothelial growth factor (VEGF) signaling, leading to enhanced cell proliferation, invasion, and angiogenesis. IGHG1-silencing can suppress the neoplastic characteristics of breast cancer cells in vitro and suppresses tumor growth in nude mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86338277998

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
dcp
Lowell, US
★★★★★ 5
Very cute, good quality
Style: Lambchop, Size: 10", Style: Lambchop, Size: 10"
Our Two year-old Great Pyrenees rescue loves her Lambchop. She’s fairly gentle with it, but it did accidentally rip so we had replace it since she loves it so much. No fault of the product. The product is very well made, She just got a little rough with it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
E
Verified Purchase
Em
Pawtucket, US
★★★★★ 5
We <3 big lambchops
Style: White, Size: 24" Jumbo, Style: White, Size: 24" Jumbo
These are my vizsla's absolute FAVORITE toy. I mean, she doesn't leave the room without bringing at least one. We've bought several of these exact toys now and they're surprisingly durable- we've even put a few through the laundry. She loves to snuggle, nibble, and carry this toy like a security blanket. These are the big ones, so they get a little discolored from her grabbing them around the belly. The squeakers are pretty few and far between so it's generally not noisy unless she's super bored or excited. Get it, your dog will love it and they're cheaper than some of the small ones.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
N
Verified Purchase
Nahlik
Battle Creek, US
★★★★★ 5
A Classic Toy My Dog Can’t Get Enough Of!
Style: Blue Birthday Hat, Size: 10.5"
The Multipet Lamb Chop Dog Plush Toy (10.5”, Cream) is an absolute winner in our house! This adorable, nostalgic plush is just as cute as it is entertaining, and my dog fell in love with it the moment it came out of the package. Super Soft & Cuddly The material is extra plush and velvety, making it perfect for dogs who love to snuggle. It feels well-made and not scratchy like some cheaper toys. Squeakers That Keep Dogs Engaged There are multiple squeakers inside, and they’re loud enough to keep your dog excited but not obnoxious. My pup carries it around proudly and squeaks it nonstop. Great Size The 10.5” size is ideal for both small and medium to large dogs. Big enough to cuddle, small enough to toss around easily. Durable for a Plush Toy While it’s not built for heavy destroyers (no plush toy truly is), it holds up surprisingly well to daily play and lots of shaking. Overall: The Multipet Lamb Chop is a fantastic combo of cuddly plush and squeaky fun. Perfect for fetch, snuggles, or as your dog’s new favorite companion. If your dog enjoys plush toys, this is definitely one to grab. Highly recommended! 🐑🐶💛
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 11, 2025
A
Verified Purchase
Amazon Customer
New York, US
★★★★★ 5
BEST TOY!
Style: White, Size: 6"
I recently bought the Multipet INTERNATIONAL 843140 Lambchop Plush Squeak Toy Mini for my small dog, and it has quickly become her favorite toy. Here’s why this little squeak toy is a great addition to any pet’s collection: Adorable Design The Lambchop Plush Squeak Toy is absolutely adorable. It resembles the beloved character Lambchop, which adds a nostalgic charm for those who remember the classic TV show. The toy is well-crafted with a cute, friendly face and soft, plush material. Its small size makes it perfect for petite pets, and it’s just the right size for my dog to carry around and snuggle with. Engaging and Fun The built-in squeaker adds an extra layer of excitement for my pet. Every time she bites down, the squeak captures her attention and keeps her engaged for longer periods. It’s great for interactive play, fetch, and even as a comforting chew toy. My dog loves the noise it makes and often brings it to me to initiate playtime. Durable Construction Despite its soft and plush exterior, the Lambchop toy has proven to be quite durable. My dog is a moderate chewer, and after several weeks of play, the toy is still intact with no signs of wear and tear. The stitching is strong and has held up well against my dog’s playful bites and tugs. However, for very aggressive chewers, it might not last as long. Easy to Clean The toy is also relatively easy to clean. I’ve hand-washed it a few times to keep it fresh, and it dries quickly without losing its shape or squeak. The white color, while prone to getting dirty, can be easily spot-cleaned to maintain its appearance. Perfect Size for Small Pets At 6 inches, this toy is ideally sized for small dogs and even cats. It’s lightweight and easy for them to carry around. My dog can comfortably grip it in her mouth, and the toy is soft enough for her to cuddle with during nap time. Value for Money Considering its durability, engaging design, and the joy it brings to my pet, the Multipet Lambchop Plush Squeak Toy offers excellent value for money. It’s reasonably priced and provides hours of entertainment and comfort for my dog. Overall Impression Overall, the Multipet INTERNATIONAL 843140 Lambchop Plush Squeak Toy Mini is a fantastic toy for small pets. Its adorable design, engaging squeaker, and durable construction make it a worthwhile purchase. My dog loves it, and it has quickly become a staple in her toy collection. I highly recommend this toy to anyone looking for a cute and fun squeak toy for their small pet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 18, 2024
C
Verified Purchase
Cece
Los Angeles, US
★★★★★ 4
Great, but a little big…
Style: Lambchop, Size: 10"
Super soft and cute, I got this for my toy Cavapoo puppy. The different textures are perfect. It is a little bigger than I was expecting, and will probably be about the same size as my puppy when I get her, but I’m sure she’ll love it. I don’t know how safe it will be yet since I’ve yet to be able to watch her play with it, but I don’t see anywhere that could have loose strings for her to choke on, so I’d say it’s pretty safe. Overall a perfect toy for dogs, with a squeaker and nice textures for the dog to chew on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026

recommand products