SKU: 86375379444

TREM2 Fc Chimera Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TREM2 Fc Chimera Protein, HumanProduct Specification Species Human Antigen TREM2 Synonyms TREM 2, Triggering receptor expressed on monocytes 2 Accession Q9NZC2 1 Amino Acid Sequence His19 Ser174, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen TREM2
Synonyms TREM-2, Triggering receptor expressed on monocytes 2
Accession Q9NZC2-1
Amino Acid Sequence

His19-Ser174, with C-terminal Human IgG1 Fc HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Deczkowska A, Weiner A, Amit I. The physiology, pathology, and potential therapeutic applications of the TREM2 signaling pathway. Cell. (2020) 181:1207-17. 10.1016/j.cell.2020.05.003 2. Guerreiro R, Wojtas A, Bras J, Carrasquillo M, Rogaeva E, Majounie E, et al.. TREM2 variants in Alzheimer's disease. N Engl J Med. (2013) 368:117-27. 10.1056/NEJMoa1211851 3. Molgora M, Esaulova E, Vermi W, Hou J, Chen Y, Luo J, et al.. TREM2 modulation remodels the tumor myeloid landscape enhancing Anti-PD-1 immunotherapy. Cell. (2020) 182:886-900.e817. 10.1016/j.cell.2020.07.013.

Background

Triggering receptor expressed on myeloid cells-2 (TREM2) is a transmembrane receptor of the immunoglobulin superfamily and a crucial signaling hub for multiple pathological pathways that mediate immunity. Expressed in the brain, specifically in microglia and in the fusiform gyrus. TREM2 can inhibit the phagocytic function of dendritic cells and macrophages, thereby affecting related immune signaling pathways. TREM2 has vital roles in Alzheimer's disease and other neurodegenerative diseases, and is involved in numerous immune and inflammatory pathways that contribute to the etiology of these diseases. TREM2 has been studied widely in microglia, where TREM2 functions in neuronal debris clearance to counteract the inflammatory response. TREM2 can alter the morphology of tumor-infiltrating macrophages, inhibit tumor growth, and enhance checkpoint blocking therapy. TREM2 can function as a prognostic marker in various malignant tumors because of its role in tumorigenesis and tumor immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86375379444

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Public Service Announcement
Massapequa, US
★★★★★ 5
No chemicals that will be harmful!
Set name: Tube - 5 oz. 2-Pack
Ordered this mineral sunscreen looking for something simple and effective, and it’s been a solid option so far. The zinc oxide formula is the main reason I went with it. It doesn’t rely on the same chemical ingredients found in a lot of other sunscreens, which is a big plus if you’re trying to avoid that. It feels like a cleaner option overall. Coverage is good. It spreads evenly and holds up well, even with some water exposure. I’ve used it outdoors for extended periods, and it does its job without needing constant reapplication. It does leave a slight white cast at first, which is pretty typical with mineral sunscreens, but it fades in as you rub it in. Not completely invisible, but manageable. After a few uses, what stood out most is that it doesn’t have a strong smell and doesn’t irritate the skin. It just works without a lot of extras. Compared to standard chemical sunscreens, this feels more straightforward and less harsh, especially for regular use. For the price, it’s a great value. You’re getting strong sun protection without the added ingredients some people try to avoid. If you’re looking for a mineral-based sunscreen that’s effective and a bit cleaner in formulation, this is a solid choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
A
Verified Purchase
AZ since '03
West Palm Beach, US
★★★★★ 5
Great mineral sunscreen that actually works
Set name: Tube - 5 oz.
Blue Lizard Sensitive Mineral SPF 50 has become my daily go-to. It goes on smooth, doesn’t leave a weird white cast like some mineral sunscreens, and gives solid protection. I like that it’s 100% mineral with no harsh chemicals and has organic aloe vera in it, so my skin feels hydrated instead of dried out. No greasy feeling, no strong scent, and it holds up well even when I sweat a bit. Been using it for a few weeks now and it performs exactly how I want. Small bottle but a little goes a long way. Definitely recommend if you want a simple, effective mineral option.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
H
Verified Purchase
HyeYoung Cho
Massapequa, US
★★★★★ 5
Gentle, hydrating with a slight white cast
Set name: Tube - 5 oz.
Really solid mineral sunscreen. Goes on smooth, not too thick, and feels lightweight but still hydrating. It does leave a slight white cast, which I actually like since it feels like better protection. The formula feels gentle and doesn’t irritate my skin. Great for daily use, and the UV color-changing cap is a nice bonus. Would repurchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
M
Verified Purchase
Mlnkjns
Draper, US
★★★★★ 4
Great sunblock.
Set name: Stick - 0.5 oz.
Love this stuff. It’s the only sunscreen that doesn’t sting my eyes. It works really well. It goes a long way. Lil dab will do ya. Maybe I use too much each application. I live in Florida and put it on my arms and face everyday. It does leave white smudges, smears and handprints on things.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
D
Verified Purchase
Deanna Yanda
Lake Worth, US
★★★★★ 5
Fabulous product! Made my skin feel soft!
Set name: Tube - 5 oz.
This product goes on smooth and a little goes a long way. I used it today for the first time and was very pleased that it held up to my sweating in the heat doing farm work! It doesn’t bother my very sensitive skin, in fact it is quite soothing. A little goes a long way. With about a quarter size amount I was able to do both arms and my face. I was outside for several hours and didn’t burn like I usually do. It is basically unscented which is nice and isn’t sticky.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products