SKU: 86867487694

CD3 delta His Tag Protein, Cynomolgus

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD3 delta His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms T3D, CD3 DELTA, CD3D Accession 95LI8 Amino Acid Sequence Phe22 Ala105, with C terminal 8*His FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAHHHHHHHH Expression System HEK293 Molecular Weight 20 30kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Cynomolgus
Synonyms T3D, CD3-DELTA, CD3D
Accession 95LI8
Amino Acid Sequence

Phe22-Ala105, with C-terminal 8*His

FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAHHHHHHHH

Expression System HEK293
Molecular Weight 20-30kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3 delta, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3 delta plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86867487694

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cheryl
New York, US
★★★★★ 5
Beautifully written and informative
Format: Kindle
I enjoyed this book immensely and think that the author is truly a master when is comes to explaining concepts which are sometimes difficult to understand or relate to. The steps taken and process to follow in order to reach to access the Akashic Records were easy to follow and certainly, a practice I started to follow, almost daily. Although I knew a fair amount about the Akashic Records, I had not found a book to assist in actually reaching them - now I do. This book was a treasure for me and will be re-read again and again. A joy to read and comes very highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2023
V
Verified Purchase
Vashist Reddy
Charlottesville, US
★★★★★ 5
A great intro into the akashic records
Format: Kindle
I have heard about the akashic records before but have never bothered to research more about it. I was checking stuff on reiki and other metaphysic materials when i came across this book. I checked the ratings and some of the feedback and found them helpful enough for me to finally purchase it. Once i got the book i read and i was introduced to the akashic records, which is something vaster that i originally imagined. It is intricately linked with our karmic actions and burden which we are perpetuating and carrying out of our own ignorance. The author explained how we can unwind these through consulting with our own akashic records. The more aware you are of a certain pattern that you are unconsciously perpetuating, the closer you can come to stop it. So definitely, ignorance is bliss only for the fool. You can also help clean the records of other people as well. However, first my advice is to focus on yours. Help and serve yourself and then you will know when you are ready to help others. I will also advise that you purchase the meditation audio sessions wgich were explained in the book. It will be really helpful for your akashic visits when you start putting the techniques into practice. It will not happen in one sitting or it may just be for you. Everyone is different. Give a solid try. Keep persisting and you will be in records eventually. Overall i believe this book is a labor of love, clearly written. Go for it if you are into metaphysics like me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2018
L
Verified Purchase
LLB
Phoenix, US
★★★★★ 5
Wow!
Format: Kindle
I picked 5 stars because this was the book I've been searching for! I have been on a quest for enlightenment and spiritual growth for years. And needed a way to wash away the heavy feelings and the "stuck" I was feeling. And wanted to know why the same events kept happening to me. And in just a few pages I was instructed on how to reach the records with ease. I have been in the records a few times now. And have been amazed at what I learned about myself. I thought seeing the patterns would be hard. But it's not. All the information in that moment is right there. And as you unwind the karma allowing, surrender and begin to heal instantly other events that you had the same pattern happening shows up too. And even deeper healing happens. I am now well on my way. After just a few trips to the records I can already feel the positive changes happening. I no longer feel that heavy stuck feeling. I have finally found the peace, love and joy I've been missing in my life. And I think everyone should learn how to do this. For this world and the billions of people who live here needs more love now more than ever. Thank you Melissa for writing a book so easy to use and understand. Love and Light, Peace and Love to all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 30, 2018
T
Verified Purchase
Terry Vartanyan
Fort Morgan, US
★★★★★ 5
Both fascinating and practical for our lives
Format: Kindle
Not only was this book informative and a real thrill to read, I feel driven to heal what I can in this life, and then also ask for gifts that may have been unreachable due to fear and other blocks. Grateful to have found this book, a real gift to me!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2025
B
Verified Purchase
Brian Halley
Boise, US
★★★★★ 5
Wow, informative must for career path
Format: Paperback, Format: Paperback
Great resource for any student, young or old. Solid advice and support continues with bonuses after you read with links and resources. Even some one on one with the author, worth much more than the initial cost of the book. Very informative and uplifting. The author wants to make your career choice path easier. A must have for college bound students. It’s like finding a treasure map to all the right ideas! Front to back a super read. I purchased the physical copy and plan to share it with a high school student.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2022

recommand products