SKU: 87453694332

Human IL-6

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6Product Specification Species Human Synonyms Interleukin 6, B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2), IL6, IFNB2 Accession P05231 Amino Acid Sequence Protein sequence (P05231, Val30 Met212)

Product Specification


Species Human
Synonyms Interleukin-6, B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2), IL6, IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence (P05231, Val30-Met212) VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Expression System HEK293
Molecular Weight

Predicted MW: 20.8 kDa Observed MW: 20, 21 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic. IL-6 stimulates the inflammatory and auto-immune processes in many diseases such as multiple sclerosis, neuromyelitis optica spectrum disorder (NMOSD), diabetes, atherosclerosis, depression, Alzheimer's disease, systemic lupus erythematosus, multiple myeloma, prostate cancer, Behçet's disease, rheumatoid arthritis, and intracerebral hemorrhage.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87453694332

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
SANIA
Belleville, US
★★★★★ 5
Great Everyday Cleanser
One of the best affordable cleansers i’ve ever bought— as someone who’s struggled with hormonal acne for 5 years. Being into skincare for this long, it was hard to find cleansers that were clarifying and effective. Not only have I repurchased this item 4x already, but my family loves it as well. The ingredients are great and the price is amazing for the size. It leaves a good finish on my skin, helping myself feel more clean. The gel consistency is great as someone who’s struggled with both oily and dry skin— it’s been a perfect medium in times of accutane (where my skin was extremely dry) and when oily skin. This doesn’t dry out the skin at all, making it a good option. No significant smell or fragrance— overall the perfect option if you’re looking for a median cleanser.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2025
S
Verified Purchase
Sean Bozarth
Bozeman, US
★★★★★ 5
Helped Clear My Skin Fast
This cleanser really surprised me. The 2% salicylic acid works well without drying my skin out. My breakouts started calming down after a few days, and the redness around my chin went down a lot. It feels gentle but still effective.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2025
E
Verified Purchase
eileen
Port Orchard, US
★★★★★ 5
Best product and brand for my sensitive skin
Works great… this brand is great for acne, white head, dark head and all types of skin condition. I love all their products. This product in particular doesn’t make my skin dry or irritated. Eventho my skin is very sensitive to most products I haven’t had any skin issue with any of their products.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
J
Verified Purchase
Jaci
Bozeman, US
★★★★★ 4
okay so far...
I was wondering how my skin would react from this since I've been the cerave SA cleanser for a while now and didn't notice any dryness whatsoever with that. But, I've always wondered the strength or percentage of SA in the cerave (which is impossible to find out I guess...) I'm guessing it's less than 2% so I wanted to try out a cleanser with a higher % to see if there was a different. After a few days I did notice some dryness, which I suppose could be due to wintertime, but I think it's the cleanser. Not surprising, I was bracing myself for dry skin. I will probably take a break until my skin returns to normal and reintroduce this to a few times a week or something, or I may save it for the humid summers. Other than that, I like the formula, it has a very subtle scent I don't mind at all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 17, 2021
P
Verified Purchase
Paulajade
Birmingham, US
★★★★★ 5
Smooth and oil free skin
At first I was scepticle, losing hope that anything would help my oily acne prone skin. But then I ordered this, and it's magic. Now my skin is smooth, balanced, and the acne is slowly going away. Best thing of all, no more oily skin! Will be ordering again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 8, 2025

recommand products