SKU: 88174246628

EPCR/PROCR Fc Chimera Protein, Mouse

Sale price$445.50 Regular price$495.00
Save 10%

Pay in installments of $123.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPCR/PROCR Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen EPCR PROCR Synonyms Endothelial cell protein C receptor,Activated protein C receptor, APC receptor, EPCR, PROCR, CD201 Accession Q64695 Amino Acid Sequence Leu18 Ser214, with C terminal Human IgG Fc

Product Specification


Species Mouse
Antigen EPCR/PROCR
Synonyms Endothelial cell protein C receptor,Activated protein C receptor, APC receptor, EPCR, PROCR, CD201
Accession Q64695
Amino Acid Sequence

Leu18-Ser214, with C-terminal Human IgG Fc LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 65-75kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Montes, R. et al. (2012) Thromb. Haemost. 107:815. 2. Bae, J.-S. et al. (2007) Blood 110:3909. 3. Fink, K. et al. (2013) PLoS One 8:e53103. 4. Willcox, C.R. et al. (2012) Nat. Immunol. 13:872. 5. Turner, L. et al. (2013) Nature 498:502.

Background

The endothelial protein C receptor (EPCR), also known as CD201, is an approximately 50 kDa transmembrane glycoprotein expressed on vascular endothelial cells and functions as a negative regulator of thrombosis. EPCR inhibits thrombosis through its interactions with Protein C, activated Protein C (APC), and Coagulation Factors VII, and VIIa. It enhances the activation of Protein C in response to complexes of Thrombin-Thrombomodulin. In humans, a soluble form of EPCR can be produced by alternative splicing or ADAM17/TACE mediated shedding, and this protein inhibits the anti-coagulant activity of APC. EPCR can be degraded on the surface of endothelial cells by Neutrophil Elastase. Activation of EPCR also protects vascular endothelial cells from Thrombin-induced apoptosis.EPCR binds to CD11b/CD18 (Mac-1) on monocytes and mediates monocyte adhesion to the vascular endothelium. In addition, EPCR binds to the antigen receptor on gamma δ T cells, promotes hematopoietic stem cell retention in the bone marrow, and binds to surface proteins of some species of Plasmodium, contributing to pathogenicity in severe malaria.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 88174246628

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gabby C.
Charlottesville, US
★★★★★ 5
Angels and the Fallen — Breathtaking Start
Format: Kindle
This book was EVERYTHING I expected it to be and more. Leave to R.L. Caulder and M. Sinclair to give us yet another amazing book! Kieran and her guys hooked me from the very beginning and did not let go. Found family is one of my favorite tropes and it was done so well in this book. Couple that along with an FMC trying to find her place in the world and I was practically drooling over this book. The world building, the conflict, the wyverin sidekick — it all was done so well that it felt fresh and real. Each love interest felt real and unique in their own ways. I felt connected to each one and like they were truly different people. I love that so much in a book and these two authors never miss with their love interests. Multi POV, Reverse harem, who did this to you, and a magical world highlighting the angels and the fallen. This book has everything and it does it so well. Big thank you to R.L. Caulder and M. Sinclair for the arc copy! I cannot wait for book 2!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2024
C
Verified Purchase
Chrystal
Boise, US
★★★★★ 4
A new take 🤔
Format: Kindle
I’m not going to go into what this book is about — by now you e already read the synopsis and have an idea — but I will give a couple of insights. Definitely a different take on angels and their fall; I like it. This is an interesting start to a new series - YES, this does end on a cliffhanger so be prepared for that. I’m eager for the next book (and hopefully the last in this series — sometimes the author(s) will switch it up depending on how the story flows for them) in this series. I’m hoping that a certain male character redeems himself because he’s a dick that will make the meaning of mixed signals jealous lol. You ever watch that old movie — I think it’s call Mommy Dearest? — yea, let’s switch that up to daddy. That man would make a perfect husband to mommy dearest. I recommend this book because while these authors are well known for their cliffhangers, they are also well known for putting out good stories.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2024
M
Verified Purchase
M Weidner
Belleville, US
★★★★★ 3
Liked it
Format: Kindle
I liked the worlds and the characters. The prophesy is confusing in that I would think, since all worlds ore on a path to destruction, the angels would want their world to be saved. I am sure there is more evil that will be revealed as the series proceeds. I dislike a prolonged “poor little me” trope and the main character has moved past that, thankfully, and began to show a fierce attitude as the novel progressed. The last portion of the novel had some great action. It’s worth reading, just be patient with a slow start.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2024
J
Verified Purchase
Julie R.
Boise, US
★★★★★ 5
Great start
Format: Kindle
I loved this book! It's funny but still deals with tough themes, like chronic illness, a serial killer on the loose, and a dash of self-harm. The guys are interesting and distinct, we don't know too much about them yet. It does end on a really terrible cliffhanger but on the bright side the next book is out and I believe the series is complete. I have enjoyed both of these authors separately and this is a great team up!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2025
S
Verified Purchase
S T
Chelsea, US
★★★★★ 4
Fudge!
Format: Kindle
Titles aren’t my strong suit. Sorry not sorry. That ending has me completely frustrated book two isn’t out yet. Just throwing that out there. First thing first, this is a high school book where the lead is under 18. Yea yea she’s about month from being an adult, but I can’t say I would’ve even opened the file if I’d realized. It’s not a smut fest or anything, but there is sexual tension as each party figures out their emotions. That being said, it’s a good book. There are some troubling parts, like how the supes come into their powers at 13, but most of those are dealt with in a way that makes sense. Kian is the exception. His whole arc pisses me off, especially since no one stepped in. Reflecting back on real world situations, ten or so years ago, I can see it happening, but it still makes me sick. Which, I’m sure was the whole damn point. For the most part, Courting Darkness is a fun read. I found myself laughing along with most of the set up. By the time it started getting serious, I’d grown to like the characters enough it held an impact. I’ll be adding book two to my list for when it comes out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2022

recommand products