SKU: 88332245389

Human IL-3, his tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-3, his tagProduct Specification Species Human Synonyms Hematopoietic growth factor, Mast cell growth factor (MCGF), Multipotential colony stimulating factor, P cell stimulating factor Accession P08700 Amino Acid Sequence Protein sequence (P08700, Ala20 Phe152, with C 10*His) APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFGGGGSHHHHHHHHHH Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms Hematopoietic growth factor, Mast cell growth factor (MCGF), Multipotential colony-stimulating factor, P-cell-stimulating factor
Accession P08700
Amino Acid Sequence

Protein sequence (P08700, Ala20 - Phe152, with C-10*His) APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 16.8 kDa Observed MW: 18-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin 3 (IL-3) is a protein that in humans is encoded by the IL3 gene localized on chromosome 5q31.1. Sometimes also called colony-stimulating factor, multi-CSF, mast cell growth factor, MULTI-CSF, MCGF; MGC79398, MGC79399: the protein contains 152 amino acids and its molecular weight is 17 kDa. IL-3 is produced as a monomer by activated T cells, monocytes/macrophages and stroma cells. The major function of IL-3 cytokine is to regulate the concentrations of various blood-cell types. It induces proliferation and differentiation in both early pluripotent stem cells and committed progenitors. It also has many more specific effects like the regeneration of platelets and potentially aids in early antibody isotype switching.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 88332245389

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Matthew Cirillo
Whiting, US
★★★★★ 4
Large a tad small for 11 mens supercomfy and well made
Size: Large, Color: Color Mixed(quarter Socks)
These are quality socks, but for me the large are a bit small at size 11 shoesize. They are warm in any conditions, and warm days they can feel a bit stiffling, and I have probably sweatier than average feet, so without well ventilated shoes, my feet still get damp. They are so soft and cozy in cooler/cold weather. But again, it the heat, with some sweat, this makes them a bit "slippery" and my feet slide in my shoes on steep off-camber terrain. I would probably buy these again, except I have 6 pairs, and my wife buys me expensive branded socks I'd never purchase for myself.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
K
Verified Purchase
Kindle Customer
Cuba, US
★★★★★ 5
Awesome hiking socks!
Size: Large, Color: Grey
Very comfortable and durable. I'm very happy with the quality of these sicks. I wear a mens size 11 shoe. The back of the sock come up about 1/2" above the back of my shoe. They are a perfect fit. I couldn't be happier with these. They are just the right thickness, too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
Y
Verified Purchase
Yan Wu
Birmingham, US
★★★★★ 5
Improved my foot health
Size: Medium, Color: Color Mix
I’ve been dealing with athletes foot for decades and using daily maintenance medication for longer than many people reading this have been alive. I generally don’t have any issues other than I always at least one or two nails that are cloudy and brittle. I’ve tried synthetic blends in the past but this just seemed to make things worse so I always go back to cotton. I was been reading about the benefits of wool so I thought I would try these socks. I had several clouded nails at the time but in just a few weeks of wearing wool socks I noted subtle improvements. At the time of writing this it has been over 4 months of wearing wool socks exclusively and all my nails are completely clear and healthy! I honestly can’t believe it since I haven’t had seen completely healthy nails since I was a teenager. I do continue to use daily antifungal maintenance medication but the only change has been the wool socks. I think part of the issue was the cotton socks being soaked with sweat when I took them off at the end of the day regardless of the season or activity levels. The wool socks, however, are usually dry. Even after taking them out of a hiking boot on a hot day on the trail they will feel damp but not soaked. Consequently, they dry out completely on a rock while taking a short break. By staying dry they don’t bind up and cause hot spots like cotton socks. That, and I think they just distribute the heat better than cotton and I wouldn’t be surprised if they are actually cooler on hot days. Of course, in cooler temps they are warmer and I did appreciate how much so until the other day when I wore some cotton socks that felt like I was wearing ice cubes on my feet when I was walking around my hard wood floors at the end of the day. With these particular wool ankle socks I did note a hole around the toes with a couple of the socks after a few washes. My experience with cotton socks is that even the smallest of holes will grow exponentially with each use and so I generally just discard them. At first, I was disappointed thinking that these socks would not last but it does not appear that the holes grow like cotton. In fact, I haven’t thrown one wool sock away. My eyes aren’t great at close distant but it seems like the holes I noticed disappeared. Even if they didn’t it doesn’t matter since they do not currently seem to be a problem. I haven’t had these socks long enough to notice any thinning at wear points like cotton socks but I suspect that since they don’t bind like cotton they are less prone to wear. I now have a dozen pairs of wool ankle socks and I’ve gotten in the habit of putting them in a separate bin for washing otherwise they end up getting tumble dried with the rest of the family’s close. They have been in drier a number of times and I suspect they look a little more aged as a result. If I wash them separately with other delicate items I just lay them out on the floor after washing since they aren’t noticeably wet after a spin cycle and they completely dry out overnight. At this point I would rather put on a pair of wool socks straight out of the washer then put on dry pair of cotton socks since the results would be the opposite at the end of the day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 21, 2024
M
Verified Purchase
MSNbound
Cuba, US
★★★★★ 5
Nice look, good value
Size: Large, Color: Grey Mixed(quarter Socks)
Fit great. Cushion on bottom is exactly what I wanted, top and ankle sections are much thinner as I wanted, so as not to be bulky. Expect they will well for walking and hiking. They did wash well although did lose some of the softness but did not shrink.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
C
Verified Purchase
Chris
New York, US
★★★★★ 3
Nice but issue from manufacuter.
Size: Large, Color: Ivory/Beige/Pink, Size: Large, Color: Ivory/Beige/Pink
I received the 6 pack of socks to give as an Easter present. The socks were great colors, soft, and fit well. Will be a little warm during the hotter days. Unfortunately the yellow pair came with a hole already at the toe area.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026

recommand products