Pay in installments of $33.75 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 26 - Aug 31
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP2 His Tag, HumanProduct Specification Species Human Accession P12104 Amino Acid Sequence Met1 Asp132, with C terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH Expression System E. coli Molecular Weight 16. 5kDa (Reducing) Purity 98% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution
Product Specification
| Species | Human |
| Accession | P12104 |
| Amino Acid Sequence | Met1-Asp132, with C-terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 16.5kDa (Reducing) |
| Purity | ＞98% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
FABP2 is expressed solely in the small intestine, and may control development of the small intestine particularly in response to diet. FABP2 null animals were shown to be resistant to high fat diet induced obesity. FABP2 KO mice fed a high saturated fat low fiber diet showed reduced intestinal villi length and increased transit time, as well as decreased goblet cell density and paneth cell number. Epidemiological studies have long shown that the common Ala54Thr FABP2 polymorphism in humans is associated with metabolic syndrome. The Thr54 FABP was shown to have a slightly higher affinity than the Ala54 containing protein, and human fetal intestinal explants showed that subjects with the Thr54 polymorphism had increased levels of chylomicron secretion . Thus while the complete molecular mechanisms linking these biochemical and cellular observations to the population-based observations remain to be revealed, nutritional intervention strategies may prove helpful in treating metabolic syndrome in Ala54Thr carriers.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 22 reviews
Sort
Product Reviews
★★★★★ 5
Best devotional I’ve read!
Format: Hardcover
This is one devotional I actually take time to read! Very thought provoking and relevant! Makes you stop and ponder!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2026
★★★★★ 5
Best organizer with a water spout to keep them counter dry!
Color: Black - 9.25″, Color: Black - 9.25″
I am thoroughly impressed with this product. I tried a product that goes over the middle of the sink and it blocked everything off and would always fall off in a funny ways. I had no room for my pots and pans and started getting irritated with it. This is up and out of the way has a little spicket to drain off the water and as you can see I got all of my sponge and soaps in the same spot which is wonderful cleaned off my counter beautifully. I chose the color black to blend in with my black countertop and also to look nice and clean on the counter. One of the best organizers I have ever found for a countertop. It's sturdy metal so far seems rust resistant, but I haven't had it long enough to know for sure. Mobilize easily to clean. Fabulous little sink caddy. I highly recommend to those of you that like to be organized and keep your counter nice and dry, and still arrange things so that it can be out of the way.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
★★★★★ 5
Excellent, all around caddy!
Color: Black - 9.25″
The Cisily Sink Caddy is working out nicely.
It holds my sponges, scrubbers and soap bottles. It’s easy to clean and it Excellent all around is well made. I am very happy with my purchase!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
★★★★★ 5
No Rust, No Fuss, A simple but great Sink Item
Color: Black - 9.25″
For years I just had my sponges just laying on or around the sink but this year I decided I needed something to hold the soups and cleaning detergent. Along with not being too pricy and that is how I stumbled upon this sink caddy it has worked amazingly. It holds the detergent, sponge, and tube brushes with no problem and any water is drained out from the little spout underneath it.
You can adjust the dividers so you can have how you want things separeted from each other and with the bottom being plastic you don't have to worry about getting any rust there. If you need something to make more space around your sink this item will help you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
★★★★★ 4
Functional neat and worth it!
Color: Navy Blue - 9.25″
This caddy has been even more useful than I expected. It instantly made my kitchen look cleaner and more organized compared to having wet sponges sitting on the sink. My counters look much tidier now, and the sponges dry out much better. It may seem like a small addition, but it really makes a big difference.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026