SKU: 90187707091

Canis lupus familiaris CD64, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Canis lupus familiaris CD64, His tagProduct Specification Species Canis lupus familiaris Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI Accession Q7YQJ5 Amino Acid Sequence Protein sequence (Q7YQJ5, Gln16 Pro288, with C 10*His)

Product Specification


Species Canis lupus familiaris
Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI
Accession Q7YQJ5
Amino Acid Sequence

Protein sequence (Q7YQJ5, Gln16-Pro288, with C-10*His) QTDPVKAVITLQPPWVSVFQEESVTLWCEGPHLPGDSSTQWFLNGTATQTLTPRYRIAAASVNDNGEYRCQTGLSVLSDPIQLGIHRDWLILQVSGRVFTEGEPLTLRCHGWNNKLVYNVLFYQNGTVLKFSPQNSEFTILKTTLHHNGIYHCSAMGKHRYESAGVSITIKELFPAPVLKASLSSPILEGHVVNLSCETKLLLQRPGLQLYFSFYMGSKTLLSRNTSSEYQILTAKKEDSGLYWCEATTEDGNVVKRSPELELQVVGPQTLTPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 32.2 kDaObserved MW: 33, 40, 45 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD64 (Cluster of Differentiation 64) is a type of integral membrane glycoprotein known as an Fc receptor that binds monomeric IgG-type antibodies with high affinity. It is more commonly known as Fc-gamma receptor 1 (FcγRI). After binding IgG, CD64 interacts with an accessory chain known as the common γ chain (γ chain), which possesses an ITAM motif that is necessary for triggering cellular activation. Structurally CD64 is composed of a signal peptide that allows its transport to the surface of a cell, three extracellular immunoglobulin domains of the C2-type that it uses to bind antibody, a hydrophobic transmembrane domain, and a short cytoplasmic tail. CD64 is constitutively found on only macrophages and monocytes, but treatment of polymorphonuclear leukocytes with cytokines like IFNγ and G-CSF can induce CD64 expression on these cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90187707091

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jennifer L Kasanke
New York, US
★★★★★ 5
Holds up! Good thrower!
Good quality! Throws far! Love this brand!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
M
Verified Purchase
Michael
Belleville, US
★★★★★ 4
Almost Perfect
If you’ve ever seen these things, the foldable ones are just as good as the standard ones. I just wish when you folded it up there was a way to lock it into that position. When you unfold it to play, you lock it into place with the orange locking slide so it doesn’t fold up on you. But when you’re done playing and fold it up, there’s no way to lock it into that position, it can keep unfolding if you carry it around with you, plus the orange locking slide keeps sliding up and down. It’s not a huge deal, but they could’ve made it better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
S
Verified Purchase
SC
Los Angeles, US
★★★★★ 5
Helpful
I’ve used Chuckit ball launchers, this one is foldable, great for my back pack when camping with my dog
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026
J
Verified Purchase
Jennifer Stenson
Chelsea, US
★★★★★ 5
Perfect for active dogs
This is a must-have if your dog loves to fetch. It throws the ball far with very little effort and keeps your hands clean—no more slobbery chuckit balls. Lightweight, durable, and makes playtime much more fun (and less tiring for me!).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
J
Verified Purchase
John J
Fort Morgan, US
★★★★★ 5
Way better than the M size for us
Like most people that have dogs I first went with the M size or Tennis ball size (about 2.5") chuckit for my 65-70 lbs Lab. After having that for a while and my dogs' evolution from liking to chase the ball to wanting to catch it, I started seeing how the M size could cause some life threating problems for my pup. I was on the fence for several weeks when I came across this option that included a 3" ultra ball as well as a 3" fuzzy tennis ball like ball. These balls can fly so much farther with less effort and my furry friend seeming to like them more than the 2.5 inch. It also seems to fit their mouth better allowing them to enjoy 'the game' (you lost by the way) much more. If you have a larger dog or your dog has a big mouth, please trust me when I say skip the 2.5" M size balls. You and your dog will haves much more fun with this 3" size
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2024

recommand products