SKU: 90649562857

IFN-γ His Tag Protein, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 8 - Sep 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IFN-γ His Tag Protein, HumanProduct Specification Synonyms IFN ,Immune Interferon,type II interferon,T cell interferon,MAF,IFNG,IFG,IFI,IFN gamma Accession P01579 Amino Acid Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 18. 5 kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Synonyms IFN-γ,Immune Interferon,type II interferon,T cell interferon,MAF,IFNG,IFG,IFI,IFN-gamma
Accession P01579
Amino Acid Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight 18.5 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer

0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IFN-gamma, the only member of type II interferon, is a soluble dimer cytokine secreted mainly by natural killer cells (NK) and natural killer T cells (NKT) when it functions in innate immunity. During antigen-specific immunity it is secreted by CD4 Th1 and CD8 cytotoxic T cells.IFN-gamma acts on the whole process of tumorigenesis and development, and its anti-tumor mechanism is mainly divided into immune mechanism and non-immune mechanism.IFN-gamma can directly inhibit tumor cell proliferation, promote tumor cell apoptosis, inhibit tumor angiogenesis, and cooperate with NK, NKT, γδT cells and CD4+/CD8+T cells of innate and adaptive immunity to complete tumor killing. In addition, IFN-gamma also has an important immunomodulatory function, which can improve the lysosomal activity of macrophages, and has an anti-proliferation effect on transformed cells.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90649562857

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
jessica thacker
Cuba, US
★★★★★ 5
Great suit
Size: Medium, Color: Black, Size: Medium, Color: Black
Suit fit well no wrinkles upon arrival the quality was great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
M
Verified Purchase
M
West Palm Beach, US
★★★★★ 4
💜
my 6’4” husband wore this to our wedding. it looked amazing on him 💜 everything fit pretty good except for the jacket part; that was a little big. it may fit someone who weighs a little more but my husband weighs about 165lbs. we had to tailor it a little bit. other than that, very beautiful suit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2025
S
Verified Purchase
Shanterrius Austin
Boise, US
★★★★★ 5
PUT IT ON
Size: Medium, Color: Red, Size: Medium, Color: Red
Everything about this suit is pure perfection—flawless fit, premium feel, and standout style. From the sharp tailoring to the fine details, it delivers confidence and class in every step. Whether for work or a special occasion, this suit truly exceeds expectations.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
L
Verified Purchase
LaShelle Lee
Port Orchard, US
★★★★★ 5
Impressive Quality and Style – A Perfect Prom Look!
Size: Small, Color: Maroon Collar Black
I purchased the YND Men's 3-Piece Slim Fit Tuxedo Suit Set for my son's prom, and I couldn’t be more thrilled with the results. From the moment he put it on, it was clear this suit was something special. The fit was absolutely sharp and flattering, perfectly hugging the frame without being too tight — just the right balance of tailored and comfortable. The material feels high-quality and looks even better in person — smooth, sleek, and polished. It held its shape beautifully throughout the night and gave my son a sophisticated, modern look that turned heads and earned him plenty of compliments. You can tell this suit is well-made with great attention to detail, from the stitching to the lining. It easily rivals much more expensive brands. I’m so impressed with the value and style that I’ll definitely be purchasing from this company again. If you're looking for a tuxedo that delivers elegance, confidence, and exceptional quality without breaking the bank — this is the one!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2025
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 5
A Good Value
Size: Small, Color: Black, Size: Small, Color: Black
The suit is a good value. Ordered for senior prom for my son. He is 5’10 athletic build and between 165-170 lbs so we ordered the small since he wanted a slim fit and nothing that would be very loose. The suit fit him great, not too snug , the jacket has a satin finish on the lapel and edge of pockets which gives it an elevated elegant look. The jacket has an interior pocket but the rest are just for aesthetic as they do not open. I did have to cut a small slit in order to use the pocket square. The pants fit like a glove but you may want to size up if you are very muscular. The material is light weight which is perfect for prom season or warmer weather. The vest was oversized but we were not planning to use the vest anyway. Quality: several hanging threads that needed to be snipped but no big deal, the stitching was even and straight and the interior had piping of a complimentary fabric. After a full night of dancing and activities he did not have any issues with stitching breaking or splitting of seams. The buttons are black with a silver edge which give the suit some sophisticated flair but keep this in mind if you plan to style with gold. Overall, I am very pleased with this suit considering it’s price point. It’s perfect for a teen that will attend various senior events. Shipping took 2 weeks so plan accordingly and pay attention to the expected delivery date.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2022

recommand products