SKU: 90795619338

Human NFL, His tag

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NFL, His tagProduct Specification Species Human Synonyms Neurofilament light polypeptide, NF L, 68 kDa neurofilament protein, Neurofilament triplet L protein, NEFL, NF68 Accession P07196 Amino Acid Sequence Protein sequence (P07196, Glu397 Ser472, with C 10*His) ETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 10. 2 kDa Observed MW: 15 kDa Purity 90% by SDS PAGE

Product Specification


Species Human
Synonyms Neurofilament light polypeptide, NF-L, 68 kDa neurofilament protein, Neurofilament triplet L protein, NEFL, NF68
Accession P07196
Amino Acid Sequence

Protein sequence (P07196, Glu397-Ser472, with C-10*His) ETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 10.2 kDa Observed MW: 15 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Neurofilament light polypeptide, also known as neurofilament light chain, abbreviated to NF-L or Nfl and with the HGNC name NEFL is a member of the intermediate filament protein family. The NF-L protein is encoded by the NEFL gene. Neurofilament light chain is a biomarker that can be measured with immunoassays in cerebrospinal fluid and plasma and reflects axonal damage in a wide variety of neurological disorders. It is a useful marker for disease monitoring in amyotrophic lateral sclerosis, multiple sclerosis, Alzheimer's disease, and more recently Huntington's disease. It is also promising marker for follow-up of patients with brain tumors. Higher levels of blood or CSF NF-L have been associated with increased mortality. The release of this protein reflects ongoing axonal loss. Methods used in different studies for NfL measurement are sandwich enzyme-linked immunosorbent assay (ELISA), electrochemiluminescence, and high-sensitive single molecule array (SIMOA).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90795619338

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jess
Louisville, US
★★★★★ 5
Heartwarming and adorable
Format: Kindle
It's not often that I cry happy tears but damnit this book made me well up at the end. I adored every single word of this story. It was just adorable and both women are so so sweet and while it wasn't angst free none of the angst came from miscommunication or anything cliche. This was just a great time from start to finish. I lost sleep to read and I have no regrets.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2025
R
Verified Purchase
R S Jordan
Carnegie, US
★★★★★ 4
A Captivating Romance of Love, Growth, and Second Chances
Format: Kindle
Erin Corcoran, a single mom still reeling from her divorce, hires a babysitter for the summer, never expecting to fall for her. Blair Breckenridge, fresh out of college and unsure of her future, takes the job to appease her parents but quickly finds herself drawn to Erin and her son. As their connection deepens, Erin fears Blair’s impulsive nature, while Blair must prove she’s ready for the responsibilities of love and family. Fallen Together by Erica Lee is a beautifully crafted romance that balances emotional depth with an engaging storyline. The novel delivers well-developed characters who experience genuine growth, making for an authentic and compelling read. Erin is a woman scarred by abandonment, hesitant to trust again, while Blair, despite her initial uncertainty about life, displays remarkable maturity in the way she cares for both Erin and her son, Nolan. Their dynamic is both tender and complex, as Blair proves she is more than just a carefree young woman, she is someone capable of deep love and responsibility. Nolan himself is a delightful mix of chaos and charm, adding a layer of realism and heart to the story. The novel’s strength lies in its character development and pacing. Both protagonists evolve naturally, making choices that feel true to who they are while ultimately prioritizing what matters most to them. The chemistry between Erin and Blair is undeniable, and their journey is filled with emotional nuance, humor, and warmth. With excellent plot development and a steady narrative flow, Fallen Together is a captivating read that holds engagement from start to finish. Erica Lee has crafted a romance that is not only passionate but also deeply satisfying in its exploration of trust, love, and the courage to embrace the unexpected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2025
C
Verified Purchase
Christian Gagnon
Natrona Heights, US
★★★★★ 5
A delightfully wholesome romance
Format: Kindle
This book is the perfect example of why I love Erica Lee's writing so much. She has an amazing talent for depicting love and relationships in such a wholesome and compassionate light, and it makes her books a delight to read and this is no exception. It doesn't hurt that she manages to balance humor, spice, and snark in a way that has me consistently falling in love with her characters. I seriously can't recommend this book enough. I had to force myself to put it down at 1 AM and the lost sleep was absolutely worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2025
S
Verified Purchase
Samantha Olson
Omaha, US
★★★★★ 5
heartwarming
Format: Kindle
Just a cute heartwarming story! I loved the story line behind this book especially with knowing I dated and married a single mom and eventually adopted that child as my own!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2025
L
Verified Purchase
Lisa
Los Angeles, US
★★★★★ 5
falling together
Format: Kindle
What a fantastic love story and how this family came to be. Loved Blair and how her parents accepted Erin and Nolan. The honesty of April and Marisol. A great read and you will not be disappointed…other than by the story having to end…on paper at least…not in my minds eye.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2025

recommand products