SKU: 90921579745

Human CD151 Protein, His tag

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD151 Protein, His tagProduct Specification Species Human Synonyms CD151 antigen, GP27, Membrane glycoprotein SFA 1, Platelet endothelial tetraspan antigen 3 (PETA 3), Tetraspanin 24 (Tspan 24), TSPAN24 Accession P48509 Amino Acid Sequence Protein sequence (P48509, Try115 Arg221, with C His tag) YQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Expression System HEK293 Molecular Weight Predicted MW: 13. 9 kDa

Product Specification


Species Human
Synonyms CD151 antigen, GP27, Membrane glycoprotein SFA-1, Platelet-endothelial tetraspan antigen 3 (PETA-3), Tetraspanin-24 (Tspan-24), TSPAN24
Accession P48509
Amino Acid Sequence

Protein sequence (P48509, Try115-Arg221, with C-His tag) YQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR

Expression System HEK293
Molecular Weight Predicted MW: 13.9 kDa Observed MW: 17-20 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD151 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. CD151 is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Abnormalities in CD151 have been implicated in a form of epidermolysis bullosa.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90921579745

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Rachael Jesse
Carnegie, US
★★★★★ 5
So cozy!
Color: White, Size: King, Color: White, Size: King
I absolutely love this comforter! It's very cozy, soft, and fluffy! I bought it for a duvet that I have and it fits it perfectly. It has loops on all four sides to tie a duvet and comforter together, which is really helpful. This comforter is also breathable so it helps me sleep better at night because I'm not getting overheated. The color and appearance is true to the pictures it displayed. It also seems to be quite durable and good quality. I would definitely recommend for anyone needing a new cozy comforter!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
A
Verified Purchase
Amelia Rodriguez
Birmingham, US
★★★★★ 5
Must have!
Color: Light Grey, Size: Queen
⭐⭐⭐⭐⭐ This comforter is absolutely amazing! It feels like something you'd find in a luxury hotel—soft, lightweight, airy, and incredibly comfortable. It has quickly become one of the best purchases I've made. The quality exceeded my expectations, and it's perfect for staying cozy without feeling too heavy. My kids love it so much that they're constantly trying to steal it from me! If you're looking for a comfortable, high-quality comforter, I highly recommend this one. You won't be disappointed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
D
Verified Purchase
Different from what I expected
San Leandro, US
★★★★★ 5
Cozy, warm and not heavy
Color: White, Size: Queen
This blanket is great and for a fair price, so fluffy and it’s on the warmer side but not heavy, which is exactly what I wanted!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
P
Verified Purchase
Pamela
Draper, US
★★★★★ 5
Best cheap comforter I’ve ever purchased
Color: White, Size: King, Color: White, Size: King
The comforter made of super soft and comfortable! It’s definitely cat approved, my kitty immediately fell asleep on this amazing comforter. It was super cheap. It’s easy to clean and handles bleach great. Fits my duvet cover perfectly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
K
Verified Purchase
Kyle R.
Natrona Heights, US
★★★★★ 4
Solid Affordable Duvet Insert Comforter
Color: White, Size: Queen
This is a great affordable all-season duvet insert comforter. There are multiple tie downs to attach to the duvet cover, not just the 4 corners. It is soft and washes well. It's plenty warm in the cold but might be too much during the hotter months. I live in San Diego where the average yearly temperature is at least 70 degrees. During the majority of the year this comforter ended up being too warm for me. I've used it for nearly 2 years but just replaced it with the much thinner Bedsure cooling comforter. If you're a hot sleeper or live in a warm climate, I'd recommend that product. This is still a good comforter, just not for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026

recommand products