SKU: 91511261901

Human RUNX1, His tag

Sale price$40.50 Regular price$45.00
Save 10%

Pay in installments of $11.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human RUNX1, His tagProduct Specification Species Human Synonyms Acute myeloid leukemia 1 protein, Core binding factor subunit alpha 2 (CBF alpha 2), Oncogene AML 1,PEA2 alpha B,PEBP2 alpha B, SL3 3 enhancer factor 1 alpha B subunit, SL3 AKV core binding factor alpha B subunit, AML1, CBFA2 Accession Q01196 Amino Acid Sequence Protein sequence(Q01196 Ser50 Leu183, with C 10*His)

Product Specification


Species Human
Synonyms Acute myeloid leukemia 1 protein, Core-binding factor subunit alpha-2 (CBF-alpha-2), Oncogene AML-1,PEA2-alpha B,PEBP2-alpha B, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit, AML1, CBFA2
Accession Q01196
Amino Acid Sequence

Protein sequence(Q01196 Ser50-Leu183, with C-10*His)
SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:16.7kDa Actual: 17kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Runt-related transcription factor 1 (RUNX1) also known as acute myeloid leukemia 1 protein (AML1) or core-binding factor subunit alpha-2 (CBFA2) is a protein that in humans is encoded by the RUNX1 gene. RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. In addition it plays a major role in the development of the neurons that transmit pain. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called core binding factor-α (CBFα). RUNX proteins form a heterodimeric complex with CBFβ which confers increased DNA binding and stability to the complex.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 91511261901

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dan Che
Lexington, US
★★★★★ 5
Perfect Blend of Comfort and Style
Size: 9, Color: Brown, Size: 9, Color: Brown
I recently purchased size 9 of these shoes, and they exceeded my expectations in every way! Here’s what I love about them: 1. Comfort: The moment I put them on, I noticed how soft and supportive they felt. The cushioning provides all-day comfort, making them perfect for long walks, workdays, or running errands. 2. Fit: The sizing is spot-on! I ordered my usual size, and they fit perfectly with no need to size up or down. There’s enough room for my toes to move without feeling too loose or tight. 3. Style: These shoes look even better in person. The design is sleek and versatile, making them easy to pair with both casual and semi-formal outfits. I’ve received several compliments already! 4. Durability: I put it on the day of purchase. After wearing them daily for a couple of days, they still look brand new. The stitching and material seem high-quality and built to last. 5. Value for Money: For the price, these shoes deliver exceptional value. You’re getting premium comfort and style without breaking the bank. Final Thoughts: If you’re looking for shoes that offer comfort, style, and durability, I highly recommend giving these a try. I’ll definitely be considering another pair in a different color soon! To conclude, I’m very happy for this purchase. Will definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2025
R
Verified Purchase
Roderick
New York, US
★★★★★ 5
Great Purchase
Size: 12, Color: Black
These shoes are great. They look great and extremely comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
I
Verified Purchase
Isaiah O
Houston, US
★★★★★ 5
Comfortable, Easy to Clean, and Held Up at Coachella
Size: 12, Color: White, Size: 12, Color: White
I’m really happy with this purchase. The shoes are very comfortable, and the product description is accurate. I followed the sizing recommendation based on my foot type and went one size up—they fit perfectly. I bought these for Coachella, and they definitely held up. I was on my feet all day, and they stayed comfortable the entire time. What impressed me most is how easy they were to keep clean. At the end of each day, I was able to wipe them down and maintain their whiteness without much effort. Once I got home, I gave them a deeper clean, and they honestly looked as good as new. Even the laces cleaned up easily. Now I’ve transitioned them into my regular work shoes, and they still look great. Overall, I’m very satisfied with this purchase and would definitely recommend them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
H
Verified Purchase
Hawaiian
Omaha, US
★★★★★ 4
Great shoes that are well made, lite weight, and comfortable.
Size: 12, Color: Brown
Just received my 2nd pair of shoes from Bruno Marc in a size 12. These are really lite and comfortable. It can be dressed down to be a casual shoe or dressed up with a nice suit. These run true to size so I ordered my usual size 12 and the fit was perfect. Being my 2nd pair of Bruno Marc's, I like the quality of their shoes and each shoe is described appropriately on fit and comfort. Insole of these shoes were awesome and provided soft comfort on the feet along with a slight arch support too. Will definitely consider ordering more Bruno Marc shoes in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2025
J
Verified Purchase
JCMIV63
Dallas, US
★★★★★ 5
Cushioned, comfortable, stylish and a rubber sole!
Size: 10, Color: Brown
These shoes check multiple boxes for me, comfortable, cushioned, rubber sole and stylish. As my feet grow old and worn out, I'm on a constant search for comfortable, cushioned shoes that are suitable for work and dressier occasions. I have tried many expensive shoes that look great but either lack cushioning, arch support and or comfort. One of the nice things is these shoes have a rubber sole, where most cushioned shoes have the foam soles which are great, but they tend to lack grip particularly when its damp/wet. They have average arch support, but the insole is removable and I put my own cushioned arch support. Love these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026

recommand products