SKU: 93602446409

GIPR Fc Chimera Protein, Human

Sale price$342.00 Regular price$380.00
Save 10%

Pay in installments of $95.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GIPR Fc Chimera Protein, HumanProduct Specification Species Human Accession P48546 1 Amino Acid Sequence Arg22 Gln138, with C terminal Human IgG Fc

Product Specification


Species Human
Accession P48546-1
Amino Acid Sequence Arg22-Gln138, with C-terminal Human IgG Fc RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 45-54kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Glucose-dependent insulinotropic polypeptide receptor (GIPR) are G protein-coupled receptors belonging to the secretin receptor super-family, also known as class B1. GIPR comprises an N-terminal extracellular domain (ECD), a central domain consisting of seven transmembrane α-helices, and a C-terminal, cytoplasmic domain that mediates intracellular signal transduction by physical association with the G protein. GIPR increases insulin secretion in hyperglycemia and stimulates glucagon release in hypoglycemia. It also plays an important role in adipogenesis, islet β cell proliferation and insulin release, and is associated with type 2 diabetes, obesity and neurodegenerative diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93602446409

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sarah Kendziorski
Lexington, US
★★★★★ 3
Nice balls but arrived with a bad chemical smell
Color: 12 Tennis Ball
Wonderful Product!!! The balls themselves are amazing and the squeaker in them my dog loves. I am giving them only a three star because they arrived and they SMELL like chemicals so bad!!! I was afraid to give it to my dog so i washed one out and put it up hoping the chemical smell will go away. This not good for a dog as unknown chemicals can make them really sick. Whatever amazon is spraying on their stuff it's not good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2025
B
Verified Purchase
Brandi G
Chelsea, US
★★★★★ 5
Puppy tested & approved
Color: 12 Tennis Ball
I ordered these squeaky tennis balls for my cocker spaniel. She absolutely loves these tennis balls with the squeakers in them! She plays with them all day, and chews on them frequently. We have not had any problems with her, breaking the tennis balls, which is generally the issue we have with her. The tennis ball fuzz stays on the ball very well, which is usually an issue with standard tennis balls, because my dog likes to peel off the yellow fuzz on all tennis balls. She has not been able to do that with these. I will definitely be buying these again , but will not need to anytime soon as these are extremely well built.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 25, 2022
K
Verified Purchase
Kindle Customer
Houston, US
★★★★★ 5
My dogs love these things
Color: 12 Tennis Ball
My dogs love these things. I think I bought it twice now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 15, 2026
K
Verified Purchase
Ken
Battle Creek, US
★★★★★ 5
Tennis balls
Color: Squeaky-Multi Colors, Size: 2.5"(Medium)-12 Pack
Nice tennis balls, my dog loves them! Great value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
L
Verified Purchase
Lynn Dion
Lowell, US
★★★★★ 5
Bright color and tough skin both great
Color: Regular-Orange, Size: 2.5"(Medium)-12 Pack
These tennis-style balls are, as promised, much tougher and thicker-skinned than an ordinary tennis ball, being made as a fetching ball for dogs. I bought them as foot covers for the legs of walkers used by the elderly, a very popular use. They work extremely well to protect rugs and flooring, and to make a quiet gliding cover, easier for seniors to move smoothly without snags. The usual tennis balls used for this purpose wear out pretty quickly, but this ball was made to be repeatedly fetched and gnawed on by your Rottweiler, so it's a big improvement. You will need a good cutting tool to score in the crosswise slits where you insert the walker leg; it's too tough for your household scissors, but that's just the point, right? It's tough. Very much recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2024

recommand products