SKU: 94141763025

Monkeypox virus A29L, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Monkeypox virus A29L, His TagProduct Specification Species MPXV Synonyms Mpox, Monkeypox Accession Q9YN60 Amino Acid Sequence MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight 14. 2 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution Reconstitute no more than 1 mg mL according to

Product Specification


Species MPXV
Synonyms Mpox, Monkeypox
Accession Q9YN60
Amino Acid Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight 14.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Use within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

Background

A29L is highly homologous to Vaccinia virus envelope protein A27. A27 has multiple functions and is conserved in the Orthopoxvirus genus of the poxvirus family. A27 protein binds to cell surface heparan sulfate, provides an anchor for A26 protein packaging into mature virions, and is essential for egress of mature virus (MV) from infected cells. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94141763025

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kristi
Omaha, US
★★★★★ 4
Cute and comfortable
Color: Pattern Leopard, Size: Medium
Comfortable and cute. A little long but still wear them with no issues. The material is light but synthetic so not really breathable. I foresee wearing them often.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
V
Verified Purchase
VAIMW
Chelsea, US
★★★★★ 5
The Perfect Water Shoe
Size: 6 Women/5 Men, Color: 1a-407 White
The SEEKWAY Water Shoes are an outstanding choice for anyone seeking both comfort and functionality in aquatic footwear. Designed to fit true to size, they eliminate the hassle of guessing or sizing up, ensuring a snug, reliable fit that adapts well to various foot shapes. The flexible upper material hugs your feet gently, offering a barefoot feeling without sacrificing support. Ease of wear is a highlight: the shoes slip on and off effortlessly, making them ideal for quick transitions between water and land. Whether you’re heading to the beach, preparing for a swim in the pool, or starting a kayaking adventure, you’ll appreciate how convenient and lightweight these aqua socks are. The stretchable fabric and minimal design contribute to their versatility—packing them takes up hardly any space, and they won’t weigh you down as you move. Quick-drying capabilities are another strong advantage. After wading through rivers or splashing in lakes, the shoes dry rapidly thanks to their breathable construction. This keeps your feet comfortable and reduces the risk of blisters, odor, or prolonged dampness. The materials used allow water to flow out easily, while also providing protection against rocks, shells, and other rough surfaces. Overall, the SEEKWAY Water Shoes blend comfort, true-to-size fitting, easy wearability, and fast drying to deliver a practical solution for a wide range of outdoor and aquatic activities. Whether you’re hiking near water, surfing, or simply enjoying a walk along the shoreline, these shoes give you the confidence and comfort you need for every adventure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2026
M
Verified Purchase
Manuel Valle Laborde
Omaha, US
★★★★★ 5
Comfortable and Great for Water Activities
Size: 10 Women/9 Men, Color: 1a-407 White
These water shoes are exactly what I was looking for. They are lightweight, comfortable, and fit true to size. The material dries quickly and feels breathable, which makes them perfect for the beach, pool, or any water activity. The sole provides good grip, even on wet surfaces, and they are easy to put on and take off. Overall, a great value for the price. I would recommend them to anyone looking for reliable and comfortable water shoes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
S
Verified Purchase
Shar O'thetropics
Bozeman, US
★★★★★ 5
I L-O-V-E these!!!!
Size: 9 Women/8 Men, Color: 1a-407 White
UPDATE: I've tried several difference sellers/brands and keep coming back to these Seekway shoes. I think the key is for me that they are one-piece like water socks with ties rather than having separate tongues. Some other brands, the tongues are long and rub against your foot. These also have a very thin heel cup unlike others that were fine for short term, but on long walks, the thicker heeled ones rubbed nasty blisters in both heels. These Seekway DID NOT. The only down side is that the soles are very thin, so even with orthotics (Happy Step memory foam), when walking for several miles, I did find the balls of my feet sore. But in time, they've actually "toughened up" and now I walk about 3 miles per night in these shoes without any issue. Just bought my third pair! These shoes are soooooo comfortable with great tread and very breathable. I LOVE these! The price is very reasonable while quality is good. I have one foot that is slightly narrower, especially in the heel, than the other. After a bit of experimenting with the elastic ties, they fit great. True to size. And they look up-scale... unlike some old beach shoes I have from a few years ago. I actually forgot I had shoes on, that's how comfy they are. These are not for support, but that's not their purpose. If you like walking around barefoot yet want protection from injury or stepping on something icky, these are perfect. I also hear some podiatrists are praising barefoot-style shoes as good for building muscles in the foot and legs. Total win!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2026
M
Verified Purchase
Mat Scott
Massapequa, US
★★★★★ 4
Good fit and comfort.
Size: 11.5 Women/10.5 Men, Color: 1o-506 Black
These fit well and are easy to wear in the water. They drain and dry quickly so you can move from wet to dry without having to change shoes. They kept my feet reasonably warm on a chilly day in the river. However the grip on the soles could be a bit better; they got pretty slippery when walking on rocks. They also don't offer much protection if you happen to step on something sharp. They're good if you need something versatile but I wouldn't recommend for serious river work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026

recommand products