SKU: 94158842964

LAG-3/CD223 His Tag Protein, Human

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LAG-3/CD223 His Tag Protein, HumanProduct Specification Species Human Accession P18627 Amino Acid Sequence Leu23 Leu450, with C terminal 8*His

Product Specification


Species Human
Accession P18627
Amino Acid Sequence

Leu23-Leu450, with C-terminal 8*His LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLHHHHHHHH

Expression System HEK293
Molecular Weight 55-65kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. The LAG3 is Biased expression in spleen (RPKM 15.1), lymph node (RPKM 8.3) and 12 other tissues. Lymphocyte activation gene 3 (LAG3) is an inhibitory checkpoint protein expressed on activated T effector, T regulatory, and natural killer cells. The main function of LAG3 is the regulation of immune homeostasis.Several studies have suggested its role in malignant and autoimmune diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94158842964

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Roderick
Waukegan, US
★★★★★ 5
Great Purchase
Size: 12, Color: Black
These shoes are great. They look great and extremely comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
I
Verified Purchase
Isaiah O
San Leandro, US
★★★★★ 5
Comfortable, Easy to Clean, and Held Up at Coachella
Size: 12, Color: White, Size: 12, Color: White
I’m really happy with this purchase. The shoes are very comfortable, and the product description is accurate. I followed the sizing recommendation based on my foot type and went one size up—they fit perfectly. I bought these for Coachella, and they definitely held up. I was on my feet all day, and they stayed comfortable the entire time. What impressed me most is how easy they were to keep clean. At the end of each day, I was able to wipe them down and maintain their whiteness without much effort. Once I got home, I gave them a deeper clean, and they honestly looked as good as new. Even the laces cleaned up easily. Now I’ve transitioned them into my regular work shoes, and they still look great. Overall, I’m very satisfied with this purchase and would definitely recommend them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
H
Verified Purchase
Hawaiian
Alexandria, US
★★★★★ 4
Great shoes that are well made, lite weight, and comfortable.
Size: 12, Color: Brown
Just received my 2nd pair of shoes from Bruno Marc in a size 12. These are really lite and comfortable. It can be dressed down to be a casual shoe or dressed up with a nice suit. These run true to size so I ordered my usual size 12 and the fit was perfect. Being my 2nd pair of Bruno Marc's, I like the quality of their shoes and each shoe is described appropriately on fit and comfort. Insole of these shoes were awesome and provided soft comfort on the feet along with a slight arch support too. Will definitely consider ordering more Bruno Marc shoes in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2025
J
Verified Purchase
JCMIV63
Boise, US
★★★★★ 5
Cushioned, comfortable, stylish and a rubber sole!
Size: 10, Color: Brown
These shoes check multiple boxes for me, comfortable, cushioned, rubber sole and stylish. As my feet grow old and worn out, I'm on a constant search for comfortable, cushioned shoes that are suitable for work and dressier occasions. I have tried many expensive shoes that look great but either lack cushioning, arch support and or comfort. One of the nice things is these shoes have a rubber sole, where most cushioned shoes have the foam soles which are great, but they tend to lack grip particularly when its damp/wet. They have average arch support, but the insole is removable and I put my own cushioned arch support. Love these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
D
Verified Purchase
DDD Projects
Natrona Heights, US
★★★★★ 5
OG Style
I am a big fan of Bruno Marc shoes. Over the years they have provided comfortable and affordable boots and shoes. These blue, tan and white soled dress sneakers are no exception. They have a nice finished look that makes them both causal and dressy. The lightweight style is still warm enough for colder mid-west winters. The box of the toes is wide and comfortable. The insole is well padded and a pleasure to wear. This is another fine pair of shoes to add to my collection and yours.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026

recommand products