SKU: 94468340388

Human CD36, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD36, His tagProduct Specification Species Human Synonyms Glycoprotein IIIb, PAS IV, PAS 4, Platelet glycoprotein IV Accession A4D1B1 Amino Acid Sequence Protein sequence(A4D1B1, Gln35 Asn439, with C 10*His)

Product Specification


Species Human
Synonyms Glycoprotein IIIb, PAS IV, PAS-4, Platelet glycoprotein IV
Accession A4D1B1
Amino Acid Sequence

Protein sequence(A4D1B1, Gln35-Asn439, with C-10*His)
QKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:47.7kDa Actual:70-95kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The CD36 antigen is an integral membrane protein found on the surface of many cell types in vertebrate animals. It imports fatty acids inside cells and is a member of the class B scavenger receptor family of cell surface proteins. CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. The protein itself belongs to the class B scavenger receptor family which includes receptors for selective cholesteryl ester uptake, scavenger receptor class B type I (SR-BI) and lysosomal integral membrane protein II (LIMP-II).CD36 has also been implicated in hemostasis, thrombosis, malaria, inflammation, lipid metabolism and atherogenesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94468340388

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tanima Mannan
Carnegie, US
★★★★★ 5
Beautiful glow
The way this makes my skin looks is heavenly. I’ve been using it on vacation and it makes my skin feel so smooth. The product is lightweight and doesn’t feel sticky on skin and the shimmer lasts all day. There’s no strong smell which I’m super happy about. Would definitely recommend this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
V
Verified Purchase
Valeria García
Waukegan, US
★★★★★ 4
Does not stain! Great body oil
It’s soooo light weight and easy to apply, you don’t need tons of it to get a nice result. It’s not very oily nor greasy at all. It DOES NOT STAIN!!!! I love that, it moisturized my skin so well, it looks so pretty and natural but I’m going to mention that the scent is a little weird, not bad but like I was expecting to smell like vanilla but it’s not vanilla… it’s something else but is ok because it’s not strong or unpleasant.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
J
Verified Purchase
jennifer
Charlottesville, US
★★★★★ 5
Smells so good and very moisturizing and not sticky
It smells so good! It’s also pretty glittery and sparkly. I’m usually not a fan of using body oil because I don’t like the stickiness of it on my body, but this body oil is very good! I’ve been mixing this body oil with my regular non-scented lotion(cerave moisturizing cream) after I shower before bed. Though by the time I wake up the next morning, the scent is gone. It’s not necessarily a bad thing since the scent can be a little bit strong when first applied, but overall it’s not too overwhelming and it’s perfect! I really enjoy using this body oil gel!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
S
Verified Purchase
Shanie
Cuba, US
★★★★★ 5
Teaaa Baby
This shimmer gel oil is teaaaa on your body. It smells good when combined with a cologne of your choice. It’s non-greasy, moisturizes the skin good and of course gives you that glow on your body needs. You must buy this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
F
Verified Purchase
Fran M
Louisville, US
★★★★★ 3
I was DISAPPOINTED
I was very excited to try this bc of the shimmer and glow and bc I’m a vanilla scent girly and I was disappointed bc it didn’t smell anything like vanilla However, I like the smooth body gel feel it wasn’t heavy and thick so that was a plus for me My bottle wasn’t wrapped or taped to prevent leaking bc when I removed it from the package I could tell something happened because there was no leaking in the bag it was just on the top where you squeeze it and almost 2 inches was gone from the bottle so I was disappointed bc the bottle is small anyways and for the price I want a full bottle bc normally when I order lotions or body creams they’re packaged with some extra care and this package wasn’t 😔
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026

recommand products