Pay in installments of $25.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 30 - Sep 4
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
S100A8 Protein, HumanProduct Specification Species Human Synonyms Calgranulin A; Cystic fibrosis antigen; Leukocyte L1 complex light chain; MRP 8 Accession P05109 Amino Acid Sequence Met1 Glu93 MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Expression System E. coli Molecular Weight 12kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Storage
Product Specification
| Species | Human |
| Synonyms | Calgranulin-A; Cystic fibrosis antigen; Leukocyte L1 complex light chain; MRP-8 |
| Accession | P05109 |
| Amino Acid Sequence | Met1-Glu93 MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
| Expression System | E.coli |
| Molecular Weight | 12kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | No Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | pH7.5,20mMTris,300mM NaCl |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. . and Anna L Gharibyan (2012) Int J Mol Sci. 13(3):2893-2917 |
Background
S100A8 protein became the focus of intensive current research due to their association with numerous human disorders, including acute and chronic inflammatory conditions, autoimmune diseases, cancer, atherosclerosis, cardiomyopathies and neurodegenerative diseases, as well as due to their crucial roles in normal physiological processes within cells. S100A8 belongs to the family of low molecular weight S100 proteins (10–13 kDa) comprising 22 members to date and representing the largest subfamily of the EF-hand Ca2+-binding proteins. All S100 proteins share conserved structural motifs of two EF-hand Ca2+-binding domains connected by a variable hinge region that often confer biological activity. The tendency to form homodimers is common to all S100 proteins, including S100A8 and S100A9, with one exception—calbindin D9k is monomeric. Some members of the S100 protein family are also able to form heterodimers as observed f.e. for S100A8 and S100A9 or S100A1 and S100P, which suggests different functions for homo- and heterodimers.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy