SKU: 9596224119

Her3 His Tag Protein, Human

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Her3 His Tag Protein, HumanProduct Specification Species Human Synonyms Her3, FERLK, LCCS2, VSCN1 Accession P21860 Amino Acid Sequence Ser20 Thr643, with C terminal 10*His

Product Specification


Species Human
Synonyms Her3, FERLK, LCCS2, VSCN1
Accession P21860
Amino Acid Sequence

Ser20-Thr643, with C-terminal 10*His SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

80-95kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Zhang N. et al. (2016) HER3/ErbB3, an emerging cancer therapeutic target. Acta Biochim Biophys Sin. 48(1): 39-48.

Background

HER3 is a member of the HER (EGFR/ErbB) receptor family consisting of four closely related type 1 transmembrane receptors (EGFR, HER2, HER3, and HER4). HER receptors are part of a complex signaling network intertwined with the Ras/Raf/MAPK, PI3K/AKT, JAK/STAT, and PKC signaling pathways. Aberrant activation of the HER receptors and downstream signaling molecules tips the balance on cellular events, leading to various types of cancers. The HER3 protein is expressed in several types of tumors. That fact, together with the role of HER3 in promoting cell proliferation, implicate that targeting HER3 may have therapeutic relevance. Furthermore, expression and activation of HER3 has been linked to resistance to drugs that target other HER receptors such as agents that act on EGFR or HER2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9596224119

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
BigSkyB
San Leandro, US
★★★★★ 3
ending was very rushed
Format: Kindle
Fun premise and start but the initial story buildup took 90% of book so the characters coming together and overcoming villain of story was literally less than 25 pages. Ending felt rushed and way less thought out than the premise. The whole mom part of the story was unnecessary and hard to follow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2025
N
Verified Purchase
Nat Dubs
Birmingham, US
★★★★★ 4
Solid Omegaverse!
Format: Kindle
4.5 strong stars!🌟 Overall great story solid omegaverse. I love how they’re fighting their instincts. Lots of spice, TONS of slick and heated moments. **Slight spoiler sort of** I was nervous reading this for pretty much one reason and that was the other “O” listed. I knew it wasn’t another female and I would have been happy/fine if it was but the concern lay in not knowing or being guaranteed the smexual preferences of our three alphas so realistically this gave me anxiety on how the dynamic would work. Anyone who has read omegaverse knows there’s usually one omega in each pack. My fear was the male omega connecting only with the female omega and that dynamic doesn’t wholly work for me. To me, the male omega needs the alphas as well so I was relieved with how this turned out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2025
L
Verified Purchase
LaChante Anderson
Houston, US
★★★★★ 5
Good plot but definitely slow burn
Format: Kindle
⭐️⭐️⭐️⭐️.5|🌶️🌶️🌶️🌶️ (not a ton of spice scenes for an Omegaverse) The plot, character development, scene progression, and action throughout the story was done really well. I did wish there was better pacing for the spice. I felt like the big spice was really rushed. During some scenes the story was a little hard to follow. I think some parts could’ve been cut. Overall I would read more from this author! 💖
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2025
A
Verified Purchase
Amazon Customer
Los Angeles, US
★★★★★ 5
omg loved the story
Format: Kindle
I’ve been in a reading slump DNFing so many books and finally found a story to keep me captivated… now with that though there were still some parts that were a bit of a struggle like Tatums struggle with the past trauma she dragged that on for ever I get it pasts are hard to overcome sometimes. But honestly it was easy to get over it falling in love with all these little psychos 🤣🤣🤣 absolutely loved Kodi’s obsession with getting Easton even though he doesn’t know him but smells brownies everywhere and missing the mark it was hysterical.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2025
L
Verified Purchase
Lisa Maddison
Lexington, US
★★★★★ 4
Omegaverse with rival families.
Format: Kindle
Tatum is trying to raise enough money to treat her omega mother who has fallen catatonic due to the death of her mate. To make the money she needs she agrees to work at a gentleman's club scantily dressed. There she meets the twin Hayes brothers, Declan and Kodiak, what she doesn't know is that their younger half brother is the high school sweetheart that ghosted her after helping with her first heat. Tatum also meets Easton, the mysterious male omega that pops into her life but she finds herself strongly attracted to. I enjoyed all the characters, even those that were not major characters, the plot was good, the storyline was well done. I would recommend this book if you liked Omegaverse stories, mafia storylines, and good romance with why choose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2025

recommand products