SKU: 96482363433

Human SFTPA2 Protein, His Tag

Sale price$150.75 Regular price$167.50
Save 10%

Pay in installments of $41.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human SFTPA2 Protein, His TagProduct Specification Species Human Synonyms Pulmonary surfactant associated protein A2, PSP A, PSPA, SP A, SP A2, 35 kDa pulmonary surfactant associated protein, Alveolar proteinosis protein, Collectin 5, COLEC5, PSAP, SFTP1, SFTPA, SFTPA2B Accession Q8IWL1 Amino Acid Sequence Protein sequence (Q8IWL1, Glu21 Phe248, with C His Tag)

Product Specification


Species Human
Synonyms Pulmonary surfactant-associated protein A2, PSP-A, PSPA, SP-A, SP-A2, 35 kDa pulmonary surfactant-associated protein, Alveolar proteinosis protein, Collectin-5, COLEC5, PSAP, SFTP1, SFTPA, SFTPA2B
Accession Q8IWL1
Amino Acid Sequence

Protein sequence (Q8IWL1, Glu21-Phe248, with C-His Tag) EVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Expression System HEK293
Molecular Weight

Predicted MW: 25.8 kDa Observed MW: 33-40 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Pulmonary Surfactant-Associated Protein A2 (SP-A2) is a critical component of pulmonary surfactant, a lipoprotein complex essential for reducing surface tension in the alveoli and preventing lung collapse. Encoded by the SFTPA2 gene, it is primarily synthesized and secreted by type II pneumocytes. SP-A2 is a collectin, characterized by its collagen-like domain and carbohydrate recognition domain, which enables its key role in innate host defense. It opsonizes pathogens, enhances phagocytosis by alveolar macrophages, and modulates inflammatory responses. Genetic variants in SFTPA2 are associated with susceptibility to respiratory diseases, including pulmonary fibrosis, respiratory distress syndrome, and increased risk of severe lung infections.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 96482363433

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
George A.
Dallas, US
★★★★★ 3
Fun little ending but a new beginning for the JLA
Format: Paperback
The writing is cringe in some areas but overall it's good with a nice ending. Art is typical splash page stuff with a lot of poses and pinups. It's mostly a beat em up over the top save the Justice League with an appearance by Lobo.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2025
A
Verified Purchase
alejandro galvez
Phoenix, US
★★★★★ 2
Bland and generic.
Format: Paperback
Very bland and generic. The art was serviceable but I quickly forgot everything within a day. Nothing memorable at all. I expect more from the head Batman writer. This seemed lazy. Ending was but a whimper.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 18, 2022
C
Christopher Karm
Phoenix, US
★★★★★ 3
A Nice Standalone JL Story
Format: Paperback
Justice League: Last Ride really isn't bad, but it never shines greatness either. Superman is suffering throughout this story from the loss of a friend and ally, as well as fatigue from constantly saving people. This is the crux of so many modern Hero stories. Instead of Superman being a beacon of hope, he is dealing with personal and emotional problems. Of course we all need to do just that, however, we as readers look to comics to inspire us. Superhero stories are far less uplifting today, instead bringing characters like Superman down to a more average level. While the story has a positive ending, it comes after six issues of these characters working through their grief. In some aspects I can appreciate it, but I also don't want to stew in depression. I used to look to comics to find stories of heroes working through adversity, and relating their unrealistic situations to how I could overcome my own. Lately, the idea of metaphor seems to be dead. What I really enjoyed: Chip Zdarsky actually gave the characters individual voices. That's one up on many books being published today. It was nice to see a fairly classic Justice League lineup in action. Some of the more recent membership has been odd choices. The art from Miguel Mendonca was fantastic. I'd love to see more of his stuff. There are some great story beats and the 1st chapter is pretty compelling. What could have been better: The dad jokes sprinkled throughout the story were pretty cringey. I'm still trying to understand if Batman and Superman quipping about the pronunciation of S'Mores was supposed to be funny. The story never had a sense of dire consequences, though I'm not sure that's really a bad thing. I think a few small changes to the tone, such as Superman or Wonder Woman being more of a voice of confidence and reason would have helped. We need that beacon of hope in stories like this. Overall: Story: 6/10. A fun read, but a bit of a depressing tone. Art: 8/10. Fantastic character art. I think Miguel Mendonca will be a 9/10 artist in the coming years. Value: 7/10. Definitely worth a read and at a great price currently ($11.99 as of 10/24/22)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2022
J
Verified Purchase
jordan myers
Los Angeles, US
★★★★★ 5
A Spectacle!!
Format: Kindle
Aaron packed a LOT of Story, Political Commentary and exposition into one issue. This is a testament to what good Science Fiction and good Comics have the ability to become.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 8, 2024
S
Verified Purchase
Sean McKinney
Chelsea, US
★★★★★ 5
great opening to a unique twist
Format: Kindle
Different, in a good way. This unique twist is relevant and refreshing, and provides a fresh take on the man of steel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 22, 2025

recommand products