SKU: 96542927932

Human 14-3-3 beta, His tag

Sale price$175.50 Regular price$195.00
Save 10%

Pay in installments of $48.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human 14-3-3 beta, His tagProduct Specification Species Human Synonyms Protein 1054, Protein kinase C inhibitor protein 1 (KCIP 1) Accession P31946 Amino Acid Sequence Protein sequence (P31946, Met1 Asn246, with C 10*His)

Product Specification


Species Human
Synonyms Protein 1054, Protein kinase C inhibitor protein 1 (KCIP-1)
Accession P31946
Amino Acid Sequence

Protein sequence (P31946, Met1-Asn246, with C-10*His) MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGENGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 29.8 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

14-3-3 protein beta/alpha is a protein that in humans is encoded by the YWHAB gene. This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. It has been documented to regulate various cellular processes, including cell proliferation, signal transduction, cell cycle and apoptosis. Downregulation of YWHAB has been reported to impart suppressive effects on the proliferation of cervical and gastric cancer cells. Additionally, YWHAB was previously found to be upregulated in colon cancer cells, which is in turn associated with poorer prognosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 96542927932

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
SimplyBoldMomEdit
Phoenix, US
★★★★★ 5
Crisp, Refreshing, and a Family Favorite
Flavor Name: Kiwi Strawberry, Size: 16.9 Fl Oz (Pack of 12)
Propel Kiwi Strawberry is one of our favorites. It’s crisp, refreshing, and has just the right amount of flavor without being overpowering. The kiwi strawberry taste is especially enjoyable and makes it easy to drink throughout the day. We also like that it’s zero calorie and includes electrolytes and vitamins, making it a great option for staying hydrated during workouts or busy days. Overall, a consistently refreshing drink that we always keep stocked in the house.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
R
Verified Purchase
rsorrell
Birmingham, US
★★★★★ 5
Excellent product. But I thought they were expensive.
Flavor Name: Kiwi Strawberry, Size: 16.9 Fl Oz (Pack of 12)
This is a great product, great ingredients, excellent taste, sugar-free. My friend a actually came over and I think he drink most of them or took them home to his wife. Didn't last long and I thought they were pricey.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
H
Verified Purchase
Heydon House
Los Angeles, US
★★★★★ 5
Great tasting Propel Water
Flavor Name: Kiwi Strawberry, Size: 16.9 Fl Oz (Pack of 12)
Great-tasting and refreshing Propel is one of my to go to drinks when I want something flavorful without being overly heavy like soda. The flavors are crisp and not too sweet, and its nice bonus knowing there are added vitamins. Perfect for on-the-go or after workout. I keep coming back to it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
D
Verified Purchase
dorp
San Leandro, US
★★★★★ 5
Perfect
Flavor Name: Kiwi Strawberry, Size: 16.9 Fl Oz (Pack of 12)
Order frequently. Taste good without being over powering. Easy to use and carry around. Keeps me well hydrated.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
J
Verified Purchase
Jonny N.
Alexandria, US
★★★★★ 4
Good beverage choice to mix your colonoscopy prep powder in.
Flavor Name: Kiwi Strawberry, Size: 16.9 Fl Oz (Pack of 12)
In preparation for a colonoscopy I was allowed to mix the required prep powder in any flavored water beverage that replenishes electrolytes as long as the color was clear. I dislike water and am not good at drinking the daily minimum requirement. I had to find something I could tolerate especially with my having to drink 64 ounces in a matter of a few hours. So I started my Amazon search and based on the reviews, I purchased both the Propel Strawberry-Kiwi and the Melon flavors. I was taking a chance that at least one of the two flavors would work for me. The Strawberry-Kiwi albeit on the sweet side surprisingly tasted good after I added a ton of ice and made slushes. I really didn’t taste the Kiwi but the strawberry came through. The melon was less sweet but I did not get a real taste of melon flavor, just a hint. Since I only needed 64 ounces and each bottle is 16 oz, I only had to use 4 of the 24 bottles I purchased leaving me with 20. I’m going to continue making slushes but plan on adding fresh strawberries and melon to the mix and this way hopefully drink more while getting electrolytes. One Amazon review I read was by a couple who drank Propel daily and really felt sluggish if they skipped a day. I am hoping that by the end of consuming 20 bottles, I will also see a difference in my energy levels. The cost of Propel was extremely reasonable compared to like brands that in my opinion weren’t any different except for price. Even though Propel is sugar free, it does contain sucralose. As a I diabetic, I am not supposed to have any sugar substitutes other than stevia, but since sucralose is not one of the primary ingredients, and pretty far down the ingredient list, those 64 ounces I drank had a minimal (if any) effect on my blood sugar.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2024

recommand products