SKU: 96976910355

VHL His&AVI Tag Protein, Human

Sale price$468.00 Regular price$520.00
Save 10%

Pay in installments of $130.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VHL His&AVI Tag Protein, HumanProduct Specification Species Human Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human Amino Acid Sequence Met1 Asp213, with N terminal His SUMO & C terminal AVI Tag

Product Specification


Species Human
Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human
Amino Acid Sequence

Met1-Asp213, with N-terminal His SUMO & C-terminal AVI Tag

MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGDGLNDIFEAQKIEWHE

Expression System E.coli
Molecular Weight 45 kDa
Purity

>85% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 20 mM PB,100 mM KCl,0.1 mM EDTA ,2 mM DTT, pH 7.5
Reconstitution A hardcopy of datasheet with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 96976910355

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Jane B
Pawtucket, US
★★★★★ 4
Black stuff in tube and in balm
I bought in January and the tube has black stuff in the tube and in balm.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
M
Verified Purchase
Michelle K
Pawtucket, US
★★★★★ 5
Gentle soap, great for hands and body!
I love how gentle this oatmeal soap is. It’s perfect for sensitive skin and doesn’t irritate my hands even when they are rough. I keep one at my sink and one in the shower. The natural scent is lovely and not overpowering. A must-buy for those looking for a mild cleanser!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
S
Verified Purchase
seekro
Phoenix, US
★★★★★ 5
Itchy, red skin BE GONE!
My 94 year old father has recently had a terrible resurfacing of his psoriasis with red, itchy, flaky sores all over his body! It's been so bad that he can't even sleep at night. My heart has been aching for him BUT he is finally getting some relief from this amazing soap!! I just saw him yesterday and, compared to two weeks ago, the redness and itching has lessened considerably. Plus, he loves the way it smells! What a true JOY to know he is on the mend, in part because of this product. I am about to purchase another bar for my sister who suffers the with the same issue. THANK YOU fo making a product that actually does what it claims to do!!!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 26, 2025
R
Verified Purchase
Raizy G
Port Orchard, US
★★★★★ 5
Great Product
I’ve been using this all-natural eczema soap for the past few weeks, and I’m genuinely impressed by the results. As someone who has struggled with eczema flare-ups for years, I’ve tried countless products, but this soap stands out. First off, the ingredients are truly natural—no harsh chemicals, fragrances, or preservatives. The soap is made with soothing, skin-friendly components like coconut oil, shea butter, and chamomile extract. It lathers up nicely, creating a gentle, creamy foam that feels luxurious on the skin. What really stands out is how gentle it is on my sensitive skin. Unlike many other soaps I’ve tried, this one doesn’t dry out or irritate my eczema patches. In fact, it has a calming effect and seems to reduce redness and itching after just a few uses. I’ve noticed that my skin feels softer and more hydrated, which has helped prevent flare-ups. The scent is mild and pleasant—not overpowering, but just enough to give you a fresh, clean feeling without triggering any sensitivities. Overall, I’m thrilled with this eczema soap. It’s not only effective at soothing and moisturizing my skin, but it’s also a relief to know that I’m using something that’s completely natural and safe. If you suffer from eczema or other skin sensitivities, I highly recommend giving this soap a try. It’s definitely become a staple in my daily skincare routine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2025
M
Verified Purchase
mary l
Bozeman, US
★★★★★ 5
eczema soap
this is the best soap for my grandson he has eczema , cleared his skin after one or two baths then i lotion down with with the eczema lotion and his skin is so smooth and it's actually beautiful I will always bath him in this soap again and forever he doesn't inch anymore ,no more broken skin it holds moisture because it kind of seems like it's dry when you take taking out of bath but it healing up patches of dry skin I was happy to go see them go away but it's penetrates in the skin I don't know it's just remove all roughness no more problems thanks excellent products and
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 19, 2025

recommand products