SKU: 97036150944

Human ECP/Ribonuclease 3 Protein, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ECP/Ribonuclease 3 Protein, His TagProduct Specification Species Human Synonyms Eosinophil cationic protein, RNase 3, RNS3 Accession P12724 Amino Acid Sequence Protein sequence (P12724, Arg28 Ile160, with C His Tag) RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI Expression System HEK293 Molecular Weight Predicted MW: 17. 2 kDa Observed MW: 25 35 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Eosinophil cationic protein, RNase 3, RNS3
Accession P12724
Amino Acid Sequence

Protein sequence (P12724, Arg28-Ile160, with C-His Tag) RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Expression System HEK293
Molecular Weight Predicted MW: 17.2 kDa Observed MW: 25-35 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ribonuclease 3, commonly known as Drosha, is a Class 2 ribonuclease III enzyme crucial for microRNA (miRNA) biogenesis. Located in the nucleus, it functions as the core catalytic component of the Microprocessor complex. Its primary role is to initiate miRNA processing by cleaving long primary miRNA transcripts (pri-miRNAs) into approximately 70-nucleotide precursor miRNAs (pre-miRNAs). This precise endonucleolytic cleavage is the first and essential step in the miRNA maturation pathway, which ultimately regulates gene expression post-transcriptionally. Dysregulation of Drosha is implicated in various cancers and developmental disorders.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97036150944

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
MK
Birmingham, US
★★★★★ 5
Amazing for quality and price
Size: 10 Inch, Unit Count: 100
Love these for the price! Normally I get Walmarts off brand but this is so much better quality and delivery right to my door! Love how sturdy and leakproof they are and ease of use for party friendly events or everyday use; very versatile!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
E
Verified Purchase
Emari
Dallas, US
★★★★★ 5
Great value!
Size: 10 Inch, Unit Count: 372.0, Size: 10 Inch, Unit Count: 372.0
Nice paper plates! They’re sturdy enough to hold two fairly heavy sweet potatoes safely in one hand, they have a waxy layer so liquid and gravy don’t soak into the plate. The design is nice. For the price and the quantity alone, I’ll keep ordering these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
M
Verified Purchase
Michael sweet
Battle Creek, US
★★★★★ 4
Great for the money
Size: 10 Inch, Unit Count: 100, Size: 10 Inch, Unit Count: 100
It's really nice. A little shorter than the actual size listed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
I
Verified Purchase
Ilda Espana
Draper, US
★★★★★ 5
Sturdy and good price
Size: 10 Inch, Unit Count: 44
These plates a wide and sturdy. We use them everyday at home to minimize dirty dishes which makes cleaning really easy. We’ve had even stew on them which can be very soupy and they don’t leak and they don’t get soggy. It’s also a good price point for the amount of plates it comes with. Good for everyday use or for hosting as well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
A
Verified Purchase
Ana Tagoai
Phoenix, US
★★★★★ 5
Sturdy, Strong, and Leakproof
Size: 10 Inch, Unit Count: 100
Come on now, its paper plates, it means i don’t have to do dishes. Their sturdy, leakproof, and has a cute design. Good for parties and everyday use. Holds a lot, inexpensive compared to name brand, i would buy them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026

recommand products