SKU: 97407226346

Human LIF, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human LIF, His tagProduct Specification Species Human Synonyms Differentiation stimulating factor (D factor), Melanoma derived LPL inhibitor (MLPLI), HILDA Accession P15018 Amino Acid Sequence Protein sequence (P15018, Met1 Phe202, with C 10*His) MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFGGGGSHHHHHHHHHH

Product Specification


Species Human
Synonyms Differentiation-stimulating factor (D factor), Melanoma-derived LPL inhibitor (MLPLI), HILDA
Accession P15018
Amino Acid Sequence

Protein sequence (P15018, Met1-Phe202, with C-10*His) MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 23.7 kDa Observed MW: 33-43 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Leukemia inhibitory factor, or LIF, is an interleukin 6 class cytokine that affects cell growth by inhibiting differentiation. When LIF levels drop, the cells differentiate. LIF derives its name from its ability to induce the terminal differentiation of myeloid leukemic cells, thus preventing their continued growth. Other properties attributed to the cytokine include: the growth promotion and cell differentiation of different types of target cells, influence on bone metabolism, cachexia, neural development, embryogenesis and inflammation. It has been suggested that recombinant human LIF might help to improve the implantation rate in women with unexplained infertility. LIF is often added to stem cell culture media as an alternative to feeder cell culture, due to the limitation that feeder cells present by only producing LIF on their cell surfaces. LIF promotes self-renewal by recruiting signal transducer and activator of transcription 3 (Stat3).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97407226346

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
SkincareJunkie420
Dallas, US
★★★★★ 5
My Dogs Love This!
As a dog mom to two pups, I’m always looking for toys that encourage interactive play, and this one has been a hit. ✨ What stood out: ✔ Easy-to-grab handles ✔ Great for tug-of-war ✔ Flexible but sturdy design ✔ Floats in water ✔ Fun sensory scent ✔ Perfect size for medium dogs The dual-handle design makes it comfortable for both me and my dogs during tug games, and it feels much safer than trying to grab random rope toys. The material has enough flexibility to be comfortable while still feeling durable enough for active play. My dogs immediately took interest in it, and we’ve used it both indoors and outdoors. It’s made from a thick material that is extremely durable as well as chew resistant. My dogs go crazy over it! If your dog enjoys tug-of-war, fetch, or interactive play with their humans, this is a really fun option!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
A
Amazon Customer
Boise, US
★★★★★ 5
Quality materials, durable, and fun to play with.
This Pupstages Flex-Force tug toy is perfect for people who have two large dogs, like I do. The two-handle design is a great feature. It gives you a comfortable, secure grip during tug-of-war, which makes playtime feel more controlled. It’s also helpful if you have two dogs who want to play at the same time, because each can grab a side and get into the game. Another fun thing about the design is that the irregular shape gives it an unpredictable bounce that’s exciting for my dog who loves to fetch. The material is rubbery enough that it bounces well too. The material has a bit of flex to it, which helps absorb some of the pulling force instead of feeling rigid. That slight give makes tugging feel smoother and a little easier on both your hands and your dog’s mouth. It’s also more fun for my dogs. It’s sturdy enough for regular play, though as with most toys, extremely aggressive chewers may still wear it down over time. So far, I’ve been impressed by how sturdy it is. The material feels high-quality to me, like it’s made from very good materials. I’ve owned probably a hundred different dog toys, and this feels like one of the better made ones. One fun detail is the blueberry-apple scent. It’s not overpowering, but it’s noticeable enough to make the toy more interesting to dogs. I can smell it if I hold it up to my nose. Whether they think it smells like a gourmet treat or just “intriguing mystery object” is up to them, but it definitely adds to the appeal. The fact that it floats is a nice bonus. It opens up the option for water play, like tugging at the edge of a pool, lake, or even just retrieving it from shallow water. I have a tiny pond in my backyard, so most dog toys end up wet at some point. Size-wise, it works well for a range of breeds. It’s big enough to feel substantial but not so large that it becomes awkward to handle. It has some nice weight to it, while still being manageable for smaller dogs to carry. This is a fun, well-designed tug toy that encourages interactive play. It’s comfortable to hold, engaging for my dogs, and versatile enough for both land and water adventures. I think it’s a very good value at the current price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
L
Lynne
Waukegan, US
★★★★★ 4
Not for aggressive chewers but fun otherwise!
This flex tug toy is great for pups who loves tug of war! It is a softer material than I thought it would be, which does make it more likely to be ripped by aggressive chewers. I have a pitbull who would easily destroy this toy. Luckily, I have a smaller puppy as well, and he loves playing tug of war with it. The soft material makes it more comfortable to be held when playing. It also smells much better than most dog toys lol! The blueberry scent is great and definitely makes it more enjoyable for me to play with my dog, and he loves it too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
A
AmazonCustomer
Fort Morgan, US
★★★★★ 5
Durable + Fun Design + Smells Good Too
I chose this flex-force dog tug toy from Pupstages for my two Pitbulls. They like to wrestle and this seemed like a good option that would keep them from wrestling throat to throat. This sounds scary, but they never bring blood or even have slobber on their neck when they’re playing. I was extremely pleased with the quality of this dog boy and also the scent was bright and fun. I asked my husband to smell it before I told him what it was, he said it smelled fruity. The blueberry apple scent is pleasant and might keep it long-term from smelling like dog slobber. The materials used to make this feels very durable and it stretches easily. It’s also a fun way to play with each dog one on one or sometimes play with both of them while I pull on the other end. Even though my dogs are aggressive chewers, I don’t have any concerns about the durability of this toy. It will not be something that I leave for them to chew on when we are not playing since it was not designed for that purpose. If they accidentally get a hold of it, I don’t think it will be an issue short term if they chew on it. For the sake of comparison, I had a dog pull toy that I would have said was similar to this one. When this pull toy from Pupstages arrived, I realized there was a difference compared to a similar toy we have had a couple years. Our previous toy’s design - connected the two loops without any angle - that toy lays flat on the counter. This toy connects the two looped areas at a 90° angle to each other. I like this design. This new angle feels different when tugging for me and the dogs. I can hold the old toy and the new toy and offer to play…at least now, they are choosing this one. I hope my details, thoughts and photos help someone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
E
Elyssa Snyder
Whiting, US
★★★★★ 1
Broke Within Moments
My two medium sized dogs played tug of war ONE time and it ripped in half. Not durable at all. Did not hold up well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026

recommand products