SKU: 97725754598

FABP3 His Tag, Human

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP3 His Tag, HumanProduct Specification Species Human Accession P05413 Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Expression System E. coli Molecular Weight 15. 7 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Accession P05413
Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Expression System E.coli
Molecular Weight 15.7 kDa(Reducing)
Purity

95%,  by SDS-PAGE under reducing conditions

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid-binding protein 3 (FABP3) is a cytosolic protein found in various tissues, including heart, skeletal muscle, intestinal mucosa, liver, and kidney. It is also highly expressed in the adult brain, particularly in the pons, frontal lobe, and hippocampus. In the brain, FABP3 regulates the lipid composition of the membrane and transports fatty acids between different intracellular compartments. It is released extracellularly after neuronal damage and high cerebrospinal fluid (CSF) concentration of FABP3 is found in acute conditions, such as brain injury and stroke. CSF FABP3 concentration is also higher in conditions with neuro degeneration/neuronal damage, e.g., Alzheimer’s disease (AD), mild cognitive impairment (MCI) due to AD, dementia with Lewy bodies, and Creutzfeldt–Jakob disease. CSF FABP3 concentration correlates with cognitive decline and are associated with brain volume loss in areas selectively affected in early AD. Thus, FABP3 is suggested to be a general marker of neuronal damage.

 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97725754598

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kelly
Draper, US
★★★★★ 5
Ohhh Mr. Iguana
Size: Medium/Large, Color: Illana the Iguana - Large
Mr. Iguana is a house favorite! I got my first one of these in a barkbox and my dog loved it so much, i went on the hunt for another one. Amazon saved the day! I own about 7 of these now. They are prefect for dogs just love to chew, they hold up great! And they are heavy duty, super easy to clean! My dogs are very happy, great value for the money! Doesn't have a smell, vibrant colors! Noise level is quiet, minus my dogs chewing !
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025
S
Verified Purchase
sec682
Alexandria, US
★★★★★ 3
Not for strong chewers
Size: Medium/Large, Color: Dog Ness Monster - Large
Initially, I really liked this for my dog. She is about 8 months old and still loves to chew and destroys most toys in a few minutes. When we got this, it seemed like it would hold up for a while despite being clearly gnawed on. Unfortunately, once she focused on the softer "water" portion of the toy, that is where things went downhill with this toy. After a few short chew sessions, she was tearing chunks out of it. We had purchased a replacement since she liked the original so much, and after about 5 minutes with the replacement, she had taken enough out of the blue section that we immediately threw that one out as well. Overall while the green portion held up, the blue didn't. I can't recommend this for strong chewers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 8, 2025
G
Verified Purchase
Gary Hugo
Omaha, US
★★★★★ 4
Definitely not indestructable
Size: Medium/Large, Color: Dog Ness Monster - Large, Size: Medium/Large, Color: Dog Ness Monster - Large
I have a 1-year-old toy fox terrier (Rocky, pictured). He has been chewing on this toy for seven months now; it is one of his favorites. He has been unable to seriously damage the "ocean" portion of this toy, but as you can see from the provided image, the sea serpent has not faired that well. It is missing its snout and smaller portions of the humps. My guess is that the advertiser images showing much larger dogs with "like new" versions of the toy are just that...NEW AND UNCHEWED. I have not had to clean up bits of this toy from my floor, so I assume Rocky has been swallowing them. My hope is that the yellow material of the serpent is not chemically dangerous when exposed to digestive fluids. Rocky easily destroys plush toys in a matter of days if not hours and, consumed pieces of a small microfiber blanket that he liked to toss around and play tug-of-war with (past tense as he destroyed it and has since been trashed after I began finding feces-stained undigested pieces of it lying around). Since this toy has survived seven months and has remained recognizable, I have to agree it is durable. Just beware, if my small toy fox terrier can damage the toy as pictured, expect your large breed chewer to do similar or worse damage. Also, the toy is very heavy! When Rocky drops it down a flight of stairs, it makes a MAJOR thud at the bottom, and sometimes makes me wonder if it might crack the large tile at the bottom. I cautiously recommend the product. Note the yellow frisbee in Rocky's picture. It is only a few months old and surprisingly has not suffered any chew damage despite substantial abuse. It appears to bend in the wind like a proverbial reed, evading damage by yielding to pressure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2024
E
Verified Purchase
Elaina rice
Waukegan, US
★★★★★ 5
Dog loves it! For tough chewers for sure
Size: Medium/Large, Color: Dog Ness Monster - Large, Size: Medium/Large, Color: Dog Ness Monster - Large
Dog absolutely loves it, he’s super rough on all of his toys they usually last about 10 minutes bore they are torn to shreds. It’s lasting through his chewing so I’m happy. It’s also super cute.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
M
Verified Purchase
miriana
Houston, US
★★★★★ 5
Loch Yes
Size: Medium/Large, Color: Dog Ness Monster - Large, Size: Medium/Large, Color: Dog Ness Monster - Large
Cute toy, dog really likes it. I had my doubts when I pulled it out, and honestly so did she, but the soft part bounces, so that got her going. We've had it for about a week. My dog is ~70 lbs and a moderate chewer, and this monster still gets regular play and is holding up well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026

recommand products