SKU: 97937623322

Apolipoprotein A-I/APOA1 Protein His Tag, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Apolipoprotein A-I/APOA1 Protein His Tag, HumanProduct Specification Species Human Synonyms Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1; Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1 Accession P02647 Amino Acid Sequence Asp25 Gln267, with N 6*His

Product Specification


Species Human
Synonyms Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1;Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1
Accession P02647
Amino Acid Sequence Asp25-Gln267, with N-6*His MHHHHHHDDDDKDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ.
Expression System E.coli
Molecular Weight 29.6 kDa
Purity

>98% by SDS-PAGE and RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris-HCl, 100mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Apolipoprotein A-I/APOA1 mainly exists in high density lipoprotein (HDL) particles, which can prevent excessive accumulation of cholesterol in macrophages, form foam cells, deposit on the arterial wall, and cause atherosclerosis. The main function of APOA1 is to activate lecithin cholesterol acyltransferase (LCAT) in HDL complex, catalyze cholesterol esterification, and then dissolve more cholesterol-HDL complex, increase the cholesterol transport capacity of HDL particles and the ability of liver to metabolize cholesterol. Therefore, APOA1 is an important marker to evaluate the ability of blood cholesterol clearance.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97937623322

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Amazon Reviewer
Fort Morgan, US
★★★★★ 4
Great ingredients - very strong scent
Size: 16 Fl Oz (Pack of 1)
I have really dry skin and frequent eczema so ordered this lotion to try out. I use a standard colloidal oatmeal lotion typically and it's hard to find a good lotion that doesn't have petrolatum. This one uses olive and jojoba oils instead. I ran it through a product safety app and it scored a 93/100 which is REALLY good for an eczema lotion - the only potential problematic ingredient is peppermint leaf which can be an allergen for some folks. It comes with a pump for easy use and I didn't find the lotion too greasy or oily - it seemed to absorb well. My only problem with the lotion is how strong the tea tree oil scent is - I use eczema lotion at bedtime and the smell was so strong, it was keeping me awake. If you're sensitive to tea tree oil, that could be an issue. But it's great for daytime use and has a nice, fresh scent. It's preventing the dryness and cracking on my hands that typically happens with "normal" lotions so the oat kernel flour is doing its job. As long as you don't have an aversion to a strong tea tree oil scent, this is a perfect eczema lotion. I've only ever found a handful of them that don't use petrolatum and I appreciate that this one uses plant oils instead. It works to keep the hands from drying or cracking. The price tag is on point with the other eczema lotion I use with it currently being $21 for 16 oz. Definitely recommend this if you are looking for an ingredient-safe eczema lotion.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2025
L
Verified Purchase
Luling wang
Bozeman, US
★★★★★ 5
Works for itchy dry skin
Size: 16 Fl Oz (Pack of 1)
Works good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
D
Verified Purchase
Desert Rain
Battle Creek, US
★★★★★ 5
Best hand cream for extreme rough hands
Size: 16 Fl Oz (Pack of 1)
My husband struggles with really rough hands and it's the best thing we've found. It does have a bit of a medicinal smell, but well worth it for the relief! Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026
S
Verified Purchase
Shelia
New York, US
★★★★★ 3
Smells like a disinfectant
Size: 16 Fl Oz (Pack of 1)
I’ve been struggling with eczema terribly this winter, scratching to the point of bruising. Nothing seems to help so I figured I’d give this a try. I will say that it does provide instant relief, but it is short lived and not worth the scent. It smells terrible and reminds me of old fashion Pine Sol. I think there are better products out there. I wouldn’t buy this again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
K
Verified Purchase
Kindle Customer
Lexington, US
★★★★★ 5
Help relieved the burn
Size: 16 Fl Oz (Pack of 1)
Helped to clear up skin
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 26, 2026

recommand products